RegulonDB RegulonDB 10.8: Gene Form
   

yfiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcN yfiB rplS rpsP5\' yfiR TSS_2946 TSS_2946 TSS_2945 TSS_2945

Gene      
Name: yfiB    Texpresso search in the literature
Synonym(s): ECK2602, EG11152, b2605
Genome position(nucleotides): 2743625 --> 2744107 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.14
External database links:  
ASAP:
ABE-0008572
ECHOBASE:
EB1141
OU-MICROARRAY:
b2605
PortEco:
yfiB
STRING:
511145.b2605
COLOMBOS: yfiB


Product      
Name: lipoprotein YfiB
Synonym(s): YfiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,inner membrane
Molecular weight: 17.245
Isoelectric point: 9.019
Motif(s):
 
Type Positions Sequence
19 -> 160 CQSPQGKFTPEQVAAMQSYGFTESAGDWSLGLSDAILFAKNDYKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAMGGQIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVITTP
55 -> 151 LFAKNDYKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAMGGQIPRSNLTTQGLGKKYPIASNKTAQGRAENR
1 -> 18 MIKHLVAPLVFTSLILTG
43 -> 160 AGDWSLGLSDAILFAKNDYKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAMGGQIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVITTP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12056N
ECOCYC:
EG11152-MONOMER
ECOLIWIKI:
b2605
INTERPRO:
IPR006665
INTERPRO:
IPR036737
INTERPRO:
IPR006664
MINT:
MINT-1275809
MODBASE:
P07021
PFAM:
PF00691
PRIDE:
P07021
PRINTS:
PR01021
PROSITE:
PS51123
PROSITE:
PS51257
REFSEQ:
NP_417096
SMR:
P07021
UNIPROT:
P07021


Operon      
Name: yfiR-dgcN-yfiB         
Operon arrangement:
Transcription unit        Promoter
yfiR-dgcN-yfiB
yfiRN


Transcriptional Regulation      
Display Regulation             
Repressed by: YjjQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2945 2743141 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2946 2743327 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB