RegulonDB RegulonDB 11.0: Gene Form
   

arpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arpA aceK iclR aceK-int metHp2 metHp2 arpAp9 arpAp9 arpAp1 arpAp1 arpAp8 arpAp8

Gene      
Name: arpA    Texpresso search in the literature
Synonym(s): ECK4009, EG11208, arp, b4017, yjaC
Genome position(nucleotides): 4220301 <-- 4222487
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
37.63
External database links:  
ASAP:
ABE-0013133
ECHOBASE:
EB1193
ECOLIHUB:
arpA
OU-MICROARRAY:
b4017
STRING:
511145.b4017
COLOMBOS: arpA


Product      
Name: regulator of acetyl CoA synthetase
Synonym(s): Arp, ArpA, YjaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 82.598
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence Comment
123 -> 379 LNLKSDRKEKEFPRIKLNGQCYFPGRPQNRIVCRHIAAQYINDIYQNVDYKPHQDDYSSAEKFLTHFNKKCKNQTLALVSSRPEGRCVAACGDFGLVMKAYFDKMESNGISVMAAILLVDNHALTVRLRIKNTTEGCTHYVVSVYDPNVTNDKIRIMSESKENIKHYSLMDFMNVDYSLLKWSNDHVINQSVAIIPALPKEQLLMLKGSVDEITPPLSPATMNLLMAIGQNHQLTQLMIQLQKMPELHRTEMLTAYN
124 -> 124 N UniProt: In Ref. 4; AAA73004..
282 -> 282 S UniProt: In Ref. 4; AAA73004..
381 -> 410 INLPGLYLAINYGNADIVETIFNSLSETGY UniProt: ANK 1.
429 -> 458 NGFSGLFLAISRKDKNVVTSILNALPKLAA UniProt: ANK 2.

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P23325
DIP:
DIP-9159N
ECOCYC:
EG11208-MONOMER
ECOLIWIKI:
b4017
INTERPRO:
IPR012927
INTERPRO:
IPR002110
INTERPRO:
IPR036770
PFAM:
PF07906
PRIDE:
P23325
PROSITE:
PS50297
REFSEQ:
NP_418441
SMART:
SM00248
UNIPROT:
P23325


Operon      
Name: arpA         
Operon arrangement:
Transcription unit        Promoter
arpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter arpAp8 4222513 reverse nd [ICWHO] [1]
  promoter arpAp1 4222629 reverse nd [ICWHO] [1]
  promoter arpAp9 4222691 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB