RegulonDB RegulonDB 10.10: Gene Form
   

focA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: focA    Texpresso search in the literature
Synonym(s): ECK0895, EG11258, b0904, ycaE
Genome position(nucleotides): 953609 <-- 954466 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.95
Reference(s): [1] Sawers G., et al., 1989
External database links:  
ASAP:
ABE-0003073
CGSC:
31732
ECHOBASE:
EB1238
ECOLIHUB:
focA
OU-MICROARRAY:
b0904
STRING:
511145.b0904
COLOMBOS: focA


Product      
Name: formate channel FocA
Synonym(s): FocA, YcaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.991
Isoelectric point: 6.942
Motif(s):
 
Type Positions Sequence
192 -> 207 AFIMVLPVAMFVASGF
260 -> 279 IGNIIGGGLLVGLTYWVIYL
69 -> 85 LVGGICFSLGLILCVVC
16 -> 276 AKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTGTMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVWMSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPENFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWV
37 -> 53 LAITAGVFISIAFVFYI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0015499 - formate transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0010447 - response to acidic pH
GO:0015724 - formate transport
GO:0019664 - mixed acid fermentation
External database links:  
DIP:
DIP-9670N
ECOCYC:
FOCA-MONOMER
ECOLIWIKI:
b0904
INTERPRO:
IPR000292
INTERPRO:
IPR023271
INTERPRO:
IPR023999
INTERPRO:
IPR024002
PANTHER:
PTHR30520
PFAM:
PF01226
PRIDE:
P0AC23
PROSITE:
PS01005
PROSITE:
PS01006
REFSEQ:
NP_415424
SMR:
P0AC23
UNIPROT:
P0AC23


Operon      
Name: focA-pflB         
Operon arrangement:
Transcription unit        Promoter
pflB
pflB
pflB
pflB
pflB
focA-pflB
focA-pflB
focA-pflB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, IHF, ArcA
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1104 951504 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1105 (cluster) 951515 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1106 951822 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1107 951845 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1108 952063 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1109 952068 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1110 952083 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1111 (cluster) 952140 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1112 952158 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1113 952163 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1114 952167 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1115 (cluster) 952170 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1116 (cluster) 952183 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1117 (cluster) 952196 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1118 952199 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1119 952267 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1120 952271 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1121 952279 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1122 952397 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1123 952407 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1124 (cluster) 952421 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1125 952437 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1126 952443 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1127 952470 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1128 952479 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1129 952493 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1130 952584 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1131 952658 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1132 (cluster) 952666 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1133 952674 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1134 952677 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1135 953144 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1136 953146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1137 953199 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1138 (cluster) 953225 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1139 953227 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1140 953229 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1141 953233 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1142 (cluster) 953251 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1143 953262 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1144 (cluster) 953311 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1145 953356 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1146 953449 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1147 953452 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1148 953454 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1149 953456 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1150 953537 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1151 953573 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1154 953645 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1155 953648 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1156 (cluster) 953745 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1157 953777 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1158 (cluster) 953824 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1159 953919 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1160 953922 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1161 954185 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1162 954226 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1163 954310 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1164 954317 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1165 954328 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1166 (cluster) 954442 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1167 (cluster) 954449 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1168 954492 reverse nd [RS-EPT-CBR] [2]



RegulonDB