RegulonDB RegulonDB 10.8: Gene Form
   

ribE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ribD ribE nusB TSS_535 TSS_535 TSS_534 TSS_534 TSS_533 TSS_533 TSS_532 TSS_532 TSS_531 (cluster) TSS_531 (cluster) TSS_530 (cluster) TSS_530 (cluster) ribEp ribEp TSS_528 TSS_528

Gene      
Name: ribE    Texpresso search in the literature
Synonym(s): ECK0409, EG11322, b0415, nusIII, ribH, ybaF
Genome position(nucleotides): 434647 --> 435117 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0001444
CGSC:
35688
ECHOBASE:
EB1298
OU-MICROARRAY:
b0415
PortEco:
ribE
STRING:
511145.b0415
COLOMBOS: ribE


Product      
Name: 6,7-dimethyl-8-ribityllumazine synthase
Synonym(s): RibE, RibH, YbaF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.156
Isoelectric point: 4.914
Motif(s):
 
Type Positions Sequence
81 -> 83 TVI
13 -> 151 ARVAITIARFNNFINDSLLEGAIDALKRIGQVKDENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHVAQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVL
86 -> 87 GT
57 -> 59 AYE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.9 - riboflavin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009349 - riboflavin synthase complex
molecular_function GO:0000906 - 6,7-dimethyl-8-ribityllumazine synthase activity
GO:0016740 - transferase activity
biological_process GO:0009231 - riboflavin biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10711N
ECOCYC:
LUMAZINESYN-MONOMER
ECOLIWIKI:
b0415
INTERPRO:
IPR034964
INTERPRO:
IPR036467
INTERPRO:
IPR002180
MINT:
MINT-1225919
MODBASE:
P61714
PANTHER:
PTHR21058
PFAM:
PF00885
PRIDE:
P61714
PRODB:
PRO_000023755
REFSEQ:
NP_414949
SMR:
P61714
SWISSMODEL:
P61714
UNIPROT:
P61714


Operon      
Name: nrdR-ribDE-nusB-thiL-pgpA         
Operon arrangement:
Transcription unit        Promoter
nrdR-ribDE-nusB-thiL-pgpA
ribE-nusB-thiL-pgpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_528 434501 forward nd [RS-EPT-CBR] [1]
  promoter TSS_530 (cluster) 434511 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_531 (cluster) 434593 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_532 434596 forward nd [RS-EPT-CBR] [1]
  promoter TSS_533 434599 forward nd [RS-EPT-CBR] [1]
  promoter TSS_534 434604 forward nd [RS-EPT-CBR] [1]
  promoter TSS_535 434974 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB