RegulonDB RegulonDB 10.8: Gene Form
   

htrE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

htrE yadV yadM htrEp1 htrEp1 htrEp5 htrEp5

Gene      
Name: htrE    Texpresso search in the literature
Synonym(s): ECK0138, EG11972, b0139
Genome position(nucleotides): 152829 <-- 155426 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.34
External database links:  
ASAP:
ABE-0000479
CGSC:
30510
ECHOBASE:
EB1915
OU-MICROARRAY:
b0139
PortEco:
htrE
STRING:
511145.b0139
COLOMBOS: htrE


Product      
Name: putative fimbrial usher protein HtrE
Synonym(s): HtrE
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 95.499
Isoelectric point: 4.647
Motif(s):
 
Type Positions Sequence
51 -> 51 S
849 -> 849 E
780 -> 844 IMNITRSDGKNIPFAADIYDEQGNVIGNVGQGGQAFVRGIEQQGNISIKWLEQSKPVSCLAHYQQ
30 -> 865 AELVEYDHTFLMGQNASNIDLSRYSEGNPAIPGVYDVSVYVNDQPIINQSITFVAIEGKKNAQACITLKNLLQFHINSPDINNEKAVLLARDETLGNCLNLTEIIPQASVRYDVNDQRLDIDVPQAWVMKNYQNYVDPSLWENGINAAMLSYNLNGYHSETPGRKNESIYAAFNGGMNLGAWRLRASGNYNWMTDSGSNYDFKNRYVQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTLASFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTIEESDGSKRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTGIQITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETSTSLNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFEKKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSTSWGSYSVSAQRSWNEDGDTDDSVYLSFTIPIEKLLGTEQRTSGFQSIDTQISSDFKGNNQLNVSSSGYSDNARVSYSVNTGYTMNKASKDLSYVGGYASYESPWGTLAGSISANSDNSRQVSLSTDGGFVLHSGGLTFSNDSFSDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVELKSTSAVAVPRQGSVVFADFETVQGQSAIMNITRSDGKNIPFAADIYDEQGNVIGNVGQGGQAFVRGIEQQGNISIKWLEQSKPVSCLAHYQQSPEAEKIAQSIILNGIRCQIQ
199 -> 771 YAAFNGGMNLGAWRLRASGNYNWMTDSGSNYDFKNRYVQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTLASFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTIEESDGSKRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTGIQITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETSTSLNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFEKKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSTSWGSYSVSAQRSWNEDGDTDDSVYLSFTIPIEKLLGTEQRTSGFQSIDTQISSDFKGNNQLNVSSSGYSDNARVSYSVNTGYTMNKASKDLSYVGGYASYESPWGTLAGSISANSDNSRQVSLSTDGGFVLHSGGLTFSNDSFSDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVELKSTSAVAVPRQGSVVFADF

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0015473 - fimbrial usher porin activity
biological_process GO:0007155 - cell adhesion
GO:0009297 - pilus assembly
GO:0043711 - pilus organization
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Larsonneur F., et al., 2016
[4] Raina S., et al., 1993
[5] Wurpel DJ., et al., 2013
External database links:  
DIP:
DIP-9953N
ECOCYC:
EG11972-MONOMER
ECOLIWIKI:
b0139
INTERPRO:
IPR018030
INTERPRO:
IPR042186
INTERPRO:
IPR037224
INTERPRO:
IPR025949
INTERPRO:
IPR025885
INTERPRO:
IPR000015
MINT:
MINT-1300601
PANTHER:
PTHR30451
PFAM:
PF13954
PFAM:
PF13953
PFAM:
PF00577
PRIDE:
P33129
PRODB:
PRO_000022940
PROSITE:
PS01151
REFSEQ:
NP_414681
SMR:
P33129
UNIPROT:
P33129


Operon      
Name: yadV-htrE         
Operon arrangement:
Transcription unit        Promoter
yadV-htrE
yadV-htrE
yadV-htrE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter htrEp5 155438 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter htrEp1 155518 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Larsonneur F., Martin FA., Mallet A., Martinez-Gil M., Semetey V., Ghigo JM., Beloin C., 2016, Functional analysis of Escherichia coli Yad fimbriae reveals their potential role in environmental persistence., Environ Microbiol 18(12):5228-5248

 [4] Raina S., Missiakas D., Baird L., Kumar S., Georgopoulos C., 1993, Identification and transcriptional analysis of the Escherichia coli htrE operon which is homologous to pap and related pilin operons., J Bacteriol 175(16):5009-21

 [5] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB