RegulonDB RegulonDB 10.8: Gene Form
   

pgeF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rluD bamD pgeF ryfD clpB RyfD TSS_2929 TSS_2929 TSS_2928 TSS_2928 TSS_2927 TSS_2927 TSS_2926 TSS_2926 TSS_2925 TSS_2925 TSS_2924 TSS_2924 TSS_2923 TSS_2923 TSS_2922 TSS_2922 TSS_2921 (cluster) TSS_2921 (cluster) TSS_2920 (cluster) TSS_2920 (cluster) TSS_2919 TSS_2919 TSS_2918 TSS_2918 TSS_2917 TSS_2917 TSS_2916 (cluster) TSS_2916 (cluster) TSS_2915 TSS_2915 bamDp bamDp bamDp2 bamDp2 TSS_2914 TSS_2914 TSS_2913 TSS_2913 TSS_2912 TSS_2912 TSS_2911 TSS_2911 TSS_2910 TSS_2910 TSS_2909 TSS_2909 ryfDp ryfDp TSS_2908 (cluster) TSS_2908 (cluster) TSS_2907 TSS_2907 clpBp clpBp TSS_2905 TSS_2905 TSS_2904 (cluster) TSS_2904 (cluster)

Gene      
Name: pgeF    Texpresso search in the literature
Synonym(s): ECK2591, EG12097, b2593, yfiH
Genome position(nucleotides): 2734303 <-- 2735034 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.78
External database links:  
ASAP:
ABE-0008530
ECHOBASE:
EB2021
MIM:
604302
OU-MICROARRAY:
b2593
PortEco:
yfiH
STRING:
511145.b2593
COLOMBOS: pgeF


Product      
Name: polyphenol oxidase YfiH
Synonym(s): PgeF, YfiH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.339
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
27 -> 27 S
20 -> 241 STRIGGVSLPPYDSLNLGAHCGDNPDHVEENRKRLFAAGNLPSKPVWLEQVHGKDVLKLTGEPYASKRADASYSNTPGTVCAVMTADCLPVLFCNRAGTEVAAAHAGWRGLCAGVLEETVSCFADNPENILAWLGPAIGPRAFEVGGEVREAFMAVDAKASAAFIQHGDKYLADIYQLARQRLANVGVEQIFGGDRCTYTENETFFSYRRDKTTGRMASFIW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005507 - copper ion binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016682 - oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0042803 - protein homodimerization activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12097-MONOMER
ECOLIWIKI:
b2593
INTERPRO:
IPR003730
INTERPRO:
IPR038371
INTERPRO:
IPR011324
MODBASE:
P33644
PANTHER:
PTHR30616
PDB:
1Z9T
PFAM:
PF02578
PRIDE:
P33644
REFSEQ:
NP_417084
SMR:
P33644
UNIPROT:
P33644


Operon      
Name: rluD-pgeF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2904 (cluster) 2734197 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2905 2734202 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2907 2734207 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2908 (cluster) 2734293 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2909 2735050 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2910 2735058 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2911 2735067 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2912 2735835 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2913 2735898 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2914 2735960 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2915 2736025 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2916 (cluster) 2736071 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2917 2736085 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2918 2736248 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2919 2736286 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2920 (cluster) 2736329 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2921 (cluster) 2736345 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2922 2736549 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2923 2736555 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2924 2736559 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2925 2736561 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2926 2736565 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2927 2736586 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2928 2736612 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2929 2736658 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB