RegulonDB RegulonDB 10.8: Gene Form
   

dauA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dauA prs ychH anti-anti-terminator anti-terminator terminator TSS_1540 TSS_1540 TSS_1539 TSS_1539 TSS_1538 TSS_1538 TSS_1537 TSS_1537 TSS_1536 TSS_1536

Gene      
Name: dauA    Texpresso search in the literature
Synonym(s): ECK1194, EG12392, b1206, ychM
Genome position(nucleotides): 1259124 <-- 1260803 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0004051
ECHOBASE:
EB2293
OU-MICROARRAY:
b1206
PortEco:
ychM
STRING:
511145.b1206
COLOMBOS: dauA


Product      
Name: aerobic C4-dicarboxylate transporter DauA
Synonym(s): DauA, YchM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.429
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
29 -> 411 FTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYVLADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVM
33 -> 53 LIAGITVGIIAIPLAMALAIG
213 -> 233 LLAGCAVMGIVNLLGGHVATI
314 -> 334 LVGQGLGNIIAPFFGGITATA
80 -> 100 FSVSGPTAAFVVILYPVSQQF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015183 - L-aspartate transmembrane transporter activity
GO:0015116 - sulfate transmembrane transporter activity
GO:0008271 - secondary active sulfate transmembrane transporter activity
GO:0015138 - fumarate transmembrane transporter activity
GO:0015141 - succinate transmembrane transporter activity
biological_process GO:0015810 - aspartate transmembrane transport
GO:0008272 - sulfate transport
GO:0055085 - transmembrane transport
GO:0015741 - fumarate transport
GO:0070778 - L-aspartate transmembrane transport
GO:0071422 - succinate transmembrane transport
GO:1902358 - sulfate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Riley M., et al., 2006
[2] Serres MH., et al., 2001
External database links:  
DIP:
DIP-48160N
ECOCYC:
YCHM-MONOMER
ECOLIWIKI:
b1206
INTERPRO:
IPR001902
INTERPRO:
IPR036513
INTERPRO:
IPR018045
INTERPRO:
IPR011547
INTERPRO:
IPR002645
MODBASE:
P0AFR2
PANTHER:
PTHR11814
PDB:
3NY7
PFAM:
PF01740
PFAM:
PF00916
PRIDE:
P0AFR2
PROSITE:
PS01130
PROSITE:
PS50801
REFSEQ:
NP_415724
SMR:
P0AFR2
UNIPROT:
P0AFR2


Operon      
Name: dauA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1536 1258938 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1537 1259525 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1538 1260982 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1539 1261162 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1540 1261821 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Riley M., Abe T., Arnaud MB., Berlyn MK., Blattner FR., Chaudhuri RR., Glasner JD., Horiuchi T., Keseler IM., Kosuge T., Mori H., Perna NT., Plunkett G., Rudd KE., Serres MH., Thomas GH., Thomson NR., Wishart D., Wanner BL., 2006, Escherichia coli K-12: a cooperatively developed annotation snapshot--2005., Nucleic Acids Res 34(1):1-9

 [2] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB