RegulonDB RegulonDB 10.8: Gene Form
   

yddG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdnG yddG yddL FNR NarL FNR NarP NarL NarP NarL NarL Cis-reg terminator anti-terminator anti-anti-terminator terminator fdnGp fdnGp yddGp yddGp TSS_1829 TSS_1829

Gene      
Name: yddG    Texpresso search in the literature
Synonym(s): ECK1467, EG12713, b1473
Genome position(nucleotides): 1546288 <-- 1547169 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.66
External database links:  
ASAP:
ABE-0004912
ECHOBASE:
EB2574
OU-MICROARRAY:
b1473
PortEco:
yddG
STRING:
511145.b1473
COLOMBOS: yddG


Product      
Name: amino acid exporter YddG
Synonym(s): YddG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.539
Isoelectric point: 8.887
Motif(s):
 
Type Positions Sequence
15 -> 137 VLWSTMVGLIRGVSEGLGPVGGAAAIYSLSGLLLIFTVGFPRIRQIPKGYLLAGSLLFVSYEICLALSLGYAATHHQAIEVGMVNYLWPSLTILFAILFNGQKTNWLIVPGLLLALVGVCWVL
156 -> 176 PLSYFLAFIGAFIWAAYCTVT
183 -> 203 FNGITVFVLLTGASLWVYYFL
63 -> 83 GYLLAGSLLFVSYEICLALSL
244 -> 264 IMAVGSYFTPVLSSALAAVLL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015171 - amino acid transmembrane transporter activity
GO:0015173 - aromatic amino acid transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0032973 - amino acid export across plasma membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Daley DO., et al., 2005
[2] Grainger DC., et al., 2007
[3] Hori H., et al., 2011
[4] Jindal S., et al., 2019
[5] Santiviago CA., et al., 2002
[6] Zakataeva NP., et al., 2006
External database links:  
ECOCYC:
EG12713-MONOMER
ECOLIWIKI:
b1473
INTERPRO:
IPR000620
PFAM:
PF00892
PRIDE:
P46136
REFSEQ:
NP_415990
UNIPROT:
P46136


Operon      
Name: yddG         
Operon arrangement:
Transcription unit        Promoter
yddG


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1829 1547203 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Daley DO., Rapp M., Granseth E., Melen K., Drew D., von Heijne G., 2005, Global topology analysis of the Escherichia coli inner membrane proteome., Science 308(5726):1321-3

 [2] Grainger DC., Aiba H., Hurd D., Browning DF., Busby SJ., 2007, Transcription factor distribution in Escherichia coli: studies with FNR protein., Nucleic Acids Res 35(1):269-78

 [3] Hori H., Yoneyama H., Tobe R., Ando T., Isogai E., Katsumata R., 2011, Inducible L-alanine exporter encoded by the novel gene ygaW (alaE) in Escherichia coli., Appl Environ Microbiol 77(12):4027-34

 [4] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [5] Santiviago CA., Fuentes JA., Bueno SM., Trombert AN., Hildago AA., Socias LT., Youderian P., Mora GC., 2002, The Salmonella enterica sv. Typhimurium smvA, yddG and ompD (porin) genes are required for the efficient efflux of methyl viologen., Mol Microbiol 46(3):687-98

 [6] Zakataeva NP., Kutukova EA., Gronskii SV., Troshin PV., Livshits VA., Aleshin VV., 2006, [Export of metabolites by the proteins of the DMT and RhtB families and its possible role in intercellular communication], Mikrobiologiia 75(4):509-20

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB