RegulonDB RegulonDB 10.8: Gene Form
   

ybbY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

allB ybbY glxK ybbYp ybbYp

Gene      
Name: ybbY    Texpresso search in the literature
Synonym(s): ECK0506, G6282, b0513, glxB4
Genome position(nucleotides): 540565 --> 541866 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.23
External database links:  
ASAP:
ABE-0001771
ECHOBASE:
EB3385
OU-MICROARRAY:
b0513
PortEco:
ybbY
STRING:
511145.b0513
COLOMBOS: ybbY


Product      
Name: putative purine transporter
Synonym(s): YbbY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 47.239
Isoelectric point: 9.399
Motif(s):
 
Type Positions Sequence
103 -> 123 LAVGIALSGVLTMLIGFSGLG
289 -> 309 LITVPLAVIPFSPFVSSIGLL
320 -> 340 FIYGSVICLLVALVPALTRLF
43 -> 63 LLTLTQYAFLATALACFAQAF
9 -> 394 ESLLSGFQWFFFIFCNTVVVPPTLLSAFQLPQSSLLTLTQYAFLATALACFAQAFCGHRRAIMEGPGGLWWGTILTITLGEASRGTPINDIATSLAVGIALSGVLTMLIGFSGLGHRLARLFTPSVMVLFMLMLGAQLTTIFFKGMLGLPFGIADPNFKIQLPPFALSVAVMCLVLAMIIFLPQRFARYGLLVGTITGWLLWYFCFPSSHSLSGELHWQWFPLGSGGALSPGIILTAVITGLVNISNTYGAIRGTDVFYPQQGAGNTRYRRSFVATGFMTLITVPLAVIPFSPFVSSIGLLTQTGDYTRRSFIYGSVICLLVALVPALTRLFCSIPLPVSSAVMLVSYLPLLFSALVFSQQITFTARNIYRLALPLFVGIFLMALP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042907 - xanthine transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0042906 - xanthine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Rodriguez-Beltran J., et al., 2012
External database links:  
ECOCYC:
G6282-MONOMER
ECOLIWIKI:
b0513
INTERPRO:
IPR006043
PANTHER:
PTHR11119
PFAM:
PF00860
PRIDE:
P77328
PROSITE:
PS01116
REFSEQ:
NP_415046
UNIPROT:
P77328


Operon      
Name: gcl-hyi-glxR-ybbW-allB-ybbY-glxK         
Operon arrangement:
Transcription unit        Promoter
gcl-hyi-glxR-ybbVW-allB-ybbY-glxK
allB
allB
allB
ybbY-glxK
glxK


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Rodriguez-Beltran J., Rodriguez-Rojas A., Guelfo JR., Couce A., Blazquez J., 2012, The Escherichia coli SOS gene dinF protects against oxidative stress and bile salts., PLoS One 7(4):e34791


RegulonDB