RegulonDB RegulonDB 10.8: Gene Form
   

citD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

citF citC citE citD

Gene      
Name: citD    Texpresso search in the literature
Synonym(s): ECK0610, G6343, b0617, ybdX
Genome position(nucleotides): 650487 <-- 650783 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.89
External database links:  
ASAP:
ABE-0002124
ECHOBASE:
EB3313
OU-MICROARRAY:
b0617
PortEco:
citD
STRING:
511145.b0617
COLOMBOS: citD


Product      
Name: citrate lyase acyl carrier protein
Synonym(s): CitD, YbdX, citrate lyase, acyl carrier gamma; subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.689
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
5 -> 86 QPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAIRTTILDVLARYNVRGVQLNVDDKGALDCILRARLEALLARA
93 -> 98 PWEDCQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.4 - acyl carrier protein
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0051192 - prosthetic group binding
External database links:  
ECOCYC:
ACPSUB-MONOMER
ECOLIWIKI:
b0617
INTERPRO:
IPR006495
INTERPRO:
IPR023439
PFAM:
PF06857
PRIDE:
P69330
PRODB:
PRO_000022289
PRODOM:
PD015389
REFSEQ:
NP_415150
UNIPROT:
P69330


Operon      
Name: citCDEFXG         
Operon arrangement:
Transcription unit        Promoter
citCDEFXG
citCDEFXG


Transcriptional Regulation      
Display Regulation             
Activated by: DpiA
Repressed by: CRP, FNR, ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB