RegulonDB RegulonDB 10.8: Gene Form
   

ftsK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsK lolA lrp RcsB LexA ppGpp terminator TSS_1082 TSS_1082 TSS_1081 TSS_1081 lolAp lolAp TSS_1079 TSS_1079 TSS_1078 TSS_1078 TSS_1077 TSS_1077 TSS_1076 TSS_1076 TSS_1075 TSS_1075 TSS_1074 TSS_1074 TSS_1073 TSS_1073 TSS_1072 TSS_1072 TSS_1071 TSS_1071 TSS_1070 TSS_1070 TSS_1069 TSS_1069 TSS_1068 TSS_1068 TSS_1067 TSS_1067 TSS_1066 TSS_1066 TSS_1065 TSS_1065 ftsKp3 ftsKp3 TSS_1064 TSS_1064 ftsKp1 ftsKp1 TSS_1063 (cluster) TSS_1063 (cluster) ftsKp2 ftsKp2

Gene      
Name: ftsK    Texpresso search in the literature
Synonym(s): ECK0881, G6464, b0890, dinH
Genome position(nucleotides): 933224 --> 937213 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.01
External database links:  
ASAP:
ABE-0003027
ECHOBASE:
EB3016
OU-MICROARRAY:
b0890
PortEco:
ftsK
STRING:
511145.b0890
COLOMBOS: ftsK


Product      
Name: cell division DNA translocase FtsK
Synonym(s): DinH, FtsK, essential cell division protein FtsK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 146.662
Isoelectric point: 4.647
Motif(s):
 
Type Positions Sequence
137 -> 137 I
818 -> 943 TLLHPLLMRNGDSRPLHKPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKR
974 -> 1187 GEPVVADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNEKIAEADRMMRPIPDPYWKPGDSMDAQHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSR
25 -> 44 ALLILIVLFAVWLMAALLSF
58 -> 58 E

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.8 - SOS response
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0036121 - double-stranded DNA helicase activity
GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
GO:0015616 - DNA translocase activity
biological_process GO:0051301 - cell division
GO:0006970 - response to osmotic stress
GO:0007049 - cell cycle
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0009651 - response to salt stress
GO:0032508 - DNA duplex unwinding
GO:0007059 - chromosome segregation
GO:0043085 - positive regulation of catalytic activity
GO:0000920 - septum digestion after cytokinesis
GO:0071236 - cellular response to antibiotic
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Begg KJ., et al., 1995
[2] Berezuk AM., et al., 2014
[3] Lesterlin C., et al., 2008
External database links:  
DIP:
DIP-9703N
ECOCYC:
G6464-MONOMER
ECOLIWIKI:
b0890
INTERPRO:
IPR002543
INTERPRO:
IPR041027
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR027417
INTERPRO:
IPR025199
INTERPRO:
IPR018541
MINT:
MINT-1261773
MODBASE:
P46889
PDB:
5DCF
PDB:
2IUS
PDB:
2J5P
PFAM:
PF13491
PFAM:
PF01580
PFAM:
PF17854
PFAM:
PF09397
PRIDE:
P46889
PRODB:
PRO_000022719
PROSITE:
PS50901
REFSEQ:
NP_415410
SMART:
SM00843
SMR:
P46889
UNIPROT:
P46889


Operon      
Name: ftsK         
Operon arrangement:
Transcription unit        Promoter
ftsK
ftsK


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1063 (cluster) 933135 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1064 933181 forward nd [RS-EPT-CBR] [4]
  promoter ftsKp3 933218 forward We assigned a putative transcription
Read more >
[AIPP] [5]
  promoter TSS_1065 933716 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1066 934543 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1067 934547 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1068 934549 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1069 935748 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1070 936467 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1071 936562 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1072 936567 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1073 936589 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1074 936705 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1075 936711 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1076 936713 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1077 936735 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1078 936737 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1079 936755 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1081 937877 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1082 937932 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Begg KJ., Dewar SJ., Donachie WD., 1995, A new Escherichia coli cell division gene, ftsK., J Bacteriol 177(21):6211-22

 [2] Berezuk AM., Goodyear M., Khursigara CM., 2014, Site-directed fluorescence labeling reveals a revised N-terminal membrane topology and functional periplasmic residues in the Escherichia coli cell division protein FtsK., J Biol Chem 289(34):23287-301

 [3] Lesterlin C., Pages C., Dubarry N., Dasgupta S., Cornet F., 2008, Asymmetry of chromosome Replichores renders the DNA translocase activity of FtsK essential for cell division and cell shape maintenance in Escherichia coli., PLoS Genet 4(12):e1000288

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Lewis LK., Jenkins ME., Mount DW., 1992, Isolation of DNA damage-inducible promoters in Escherichia coli: regulation of polB (dinA), dinG, and dinH by LexA repressor., J Bacteriol 174(10):3377-85


RegulonDB