RegulonDB RegulonDB 11.1: Gene Form
   

wcaJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzxC wcaJ cpsG terminator wzxCp5 wzxCp5

Gene      
Name: wcaJ    Texpresso search in the literature
Synonym(s): ECK2041, G7098, b2047
Genome position(nucleotides): 2120160 <-- 2121554
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.62
External database links:  
ASAP:
ABE-0006785
ECHOBASE:
EB3345
ECOLIHUB:
wcaJ
OU-MICROARRAY:
b2047
STRING:
511145.b2047
COLOMBOS: wcaJ


Product      
Name: UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase
Synonym(s): WcaJ, undecaprenyl-phosphate glucose phosphotransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 52.408
Isoelectric point: 9.721
Motif(s):
 
Type Positions Sequence Comment
16 -> 36 LISMVQRFSDITIMFAGLWLV UniProt: Helical.
39 -> 59 VSGLSFLYMHLLVALITLVVF UniProt: Helical.
65 -> 238 ITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYALTSIGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDPKPGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIP
81 -> 101 FALLLQNWTLSVIFSAGLVAF UniProt: Helical.
105 -> 125 FDTQLKIWLAWYALTSIGLVV UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016757 - glycosyltransferase activity
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0089702 - undecaprenyl-phosphate glucose phosphotransferase activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Hersch SJ., et al., 2020
[2] Ranjit DK., et al., 2016
External database links:  
ALPHAFOLD:
P71241
DIP:
DIP-11125N
ECOCYC:
G7098-MONOMER
ECOLIWIKI:
b2047
INTERPRO:
IPR017473
INTERPRO:
IPR003362
INTERPRO:
IPR017475
PFAM:
PF02397
PFAM:
PF13727
PRIDE:
P71241
REFSEQ:
NP_416551
SMR:
P71241
UNIPROT:
P71241


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter wzxCp5 2120337 reverse nd [COMP-AINF] [3]


Evidence    

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol 5(5):706-714

 [2] Ranjit DK., Young KD., 2016, Colanic Acid Intermediates Prevent De Novo Shape Recovery of Escherichia coli Spheroplasts, Calling into Question Biological Roles Previously Attributed to Colanic Acid., J Bacteriol 198(8):1230-40

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB