RegulonDB RegulonDB 10.8: Gene Form
   

ypdI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfdX ypdI yfdY EvgA EvgA ypdIp1 ypdIp1 yfdXp yfdXp

Gene      
Name: ypdI    Texpresso search in the literature
Synonym(s): ECK2372, G7239, b2376
Genome position(nucleotides): 2494698 --> 2494973 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.22
External database links:  
ASAP:
ABE-0007839
ECHOBASE:
EB4119
OU-MICROARRAY:
b2376
PortEco:
ypdI
STRING:
511145.b2376
COLOMBOS: ypdI


Product      
Name: colanic acid synthesis putative lipoprotein YpdI
Synonym(s): YpdI
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 10.162
Isoelectric point: 9.194
Motif(s):
 
Type Positions Sequence
1 -> 18 MKVNLILFSLFLLVSIMA
19 -> 91 CNVFAFSISGGGSERSYKETEKTSAMTTTHSTKLQPSQAILFKMREDAPPLNLTEEMPPPFPTKANYLIHPVR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
biological_process GO:0009242 - colanic acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Potrykus J., et al., 2004
External database links:  
DIP:
DIP-12820N
ECOCYC:
G7239-MONOMER
ECOLIWIKI:
b2376
PRIDE:
O32528
PROSITE:
PS51257
REFSEQ:
NP_416877
SMR:
O32528
UNIPROT:
O32528


Operon      
Name: ypdI         
Operon arrangement:
Transcription unit        Promoter
ypdI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ypdIp1 2494494 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Potrykus J., Wegrzyn G., 2004, The ypdI gene codes for a putative lipoprotein involved in the synthesis of colanic acid in Escherichia coli., FEMS Microbiol Lett 235(2):265-71

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB