RegulonDB RegulonDB 10.8: Gene Form
   

ypdF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fryA fryC ypdF ypdE fryAp6 fryAp6

Gene      
Name: ypdF    Texpresso search in the literature
Synonym(s): ECK2381, G7248, b2385
Genome position(nucleotides): 2505547 <-- 2506632 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.81
External database links:  
ASAP:
ABE-0007869
ECHOBASE:
EB3905
OU-MICROARRAY:
b2385
PortEco:
ypdF
STRING:
511145.b2385
COLOMBOS: ypdF


Product      
Name: aminopeptidase YpdF
Synonym(s): YpdF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.624
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
134 -> 342 EKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKASFDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGEGVSAESHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEAGYGDYFGHNTGHAIGIEVHEDPRFSPRDTTTLQPGMLLTVEPGIYLPGQGGVRIEDVVLVTP
4 -> 124 LASLRDWLKAQQLDAVLLSSRQNKQPHLGISTGSGYVVISRESAHILVDSRYYVEVEARAQGYQLHLLDATNTLTTIVNQIIADEQLQTLGFEGQQVSWETAHRWQSELNAKLVSATPDVL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046914 - transition metal ion binding
GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004177 - aminopeptidase activity
GO:0042803 - protein homodimerization activity
GO:0070006 - metalloaminopeptidase activity
biological_process GO:0006508 - proteolysis
External database links:  
DIP:
DIP-48229N
ECOCYC:
G7248-MONOMER
ECOLIWIKI:
b2385
INTERPRO:
IPR036005
INTERPRO:
IPR029149
INTERPRO:
IPR001714
INTERPRO:
IPR000587
INTERPRO:
IPR000994
MODBASE:
P76524
PDB:
5CNX
PFAM:
PF01321
PFAM:
PF00557
PRIDE:
P76524
PRINTS:
PR00599
REFSEQ:
NP_416886
SMR:
P76524
SWISSMODEL:
P76524
UNIPROT:
P76524


Operon      
Name: fryBC-ypdFE-fryA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter fryAp6 2504493 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB