RegulonDB RegulonDB 10.8: Gene Form
   

fryB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fryC glk fryB anti-terminator terminator TSS_2672 TSS_2672

Gene      
Name: fryB    Texpresso search in the literature
Synonym(s): ECK2383, G7250, b2387, ypdH
Genome position(nucleotides): 2507916 <-- 2508242 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.38
External database links:  
ASAP:
ABE-0007873
ECHOBASE:
EB3907
OU-MICROARRAY:
b2387
PortEco:
fryB
STRING:
511145.b2387
COLOMBOS: fryB


Product      
Name: putative PTS enzyme IIB component FryB
Synonym(s): EIIBFry, Enzyme IIBFry, FryB, YpdH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 11.735
Isoelectric point: 4.113
Motif(s):
 
Type Positions Sequence
7 -> 98 ALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKE
1 -> 104 MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0022877 - protein-N(PI)-phosphohistidine-fructose phosphotransferase system transporter activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090582 - protein-phosphocysteine-D-fructose-phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0015755 - fructose transmembrane transport
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
G7250-MONOMER
ECOLIWIKI:
b2387
INTERPRO:
IPR013011
INTERPRO:
IPR036095
INTERPRO:
IPR003501
INTERPRO:
IPR003353
PDB:
2KYR
PFAM:
PF02302
PRIDE:
P69808
PROSITE:
PS51099
REFSEQ:
NP_416888
SMR:
P69808
UNIPROT:
P69808


Operon      
Name: fryBC-ypdFE-fryA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2672 2509416 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB