RegulonDB RegulonDB 10.8: Gene Form
   

ygcR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcU ygcS ygcQ ygcR ygcP

Gene      
Name: ygcR    Texpresso search in the literature
Synonym(s): ECK2765, G7436, b2770
Genome position(nucleotides): 2895776 <-- 2896555 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.64
External database links:  
ASAP:
ABE-0009079
ECHOBASE:
EB2926
OU-MICROARRAY:
b2770
PortEco:
ygcR
STRING:
511145.b2770
COLOMBOS: ygcR


Product      
Name: putative flavoprotein
Synonym(s): YgcR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.72
Isoelectric point: 6.898
Motif(s):
 
Type Positions Sequence
47 -> 214 AAALLLAQRKNGTPMSLTALSMGDERALHWLRYLMALGFEEAVLLETAADLRFAPEFVARHIAEWQHQNPLDLIITGCQSSEGQNGQTPFLLAEMLGWPCFTQVERFTLDALFITLEQRTEHGLRCCRVRLPAVIAVRQCGEVALPVPGMRQRMAAGKAEIIRKTVAA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7436-MONOMER
ECOLIWIKI:
b2770
INTERPRO:
IPR014730
INTERPRO:
IPR033948
INTERPRO:
IPR014729
INTERPRO:
IPR012255
MODBASE:
Q46908
PANTHER:
PTHR21294
PFAM:
PF01012
PRIDE:
Q46908
PROSITE:
PS01065
REFSEQ:
NP_417250
SMART:
SM00893
SMR:
Q46908
UNIPROT:
Q46908


Operon      
Name: ygcRQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB