RegulonDB RegulonDB 10.9: Gene Form
   

nanS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nanM yjhR nanS ythB nanSp1 nanSp1 TSS_5130 TSS_5130

Gene      
Name: nanS    Texpresso search in the literature
Synonym(s): ECK4300, G7919, b4309, yjhS
Genome position(nucleotides): 4536614 <-- 4537594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.73
External database links:  
ASAP:
ABE-0014130
ECHOBASE:
EB2449
ECOLIHUB:
nanS
OU-MICROARRAY:
b4309
STRING:
511145.b4309
COLOMBOS: nanS


Product      
Name: N-acetyl-9-O-acetylneuraminate esterase
Synonym(s): NanS, YjhS
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 36.878
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
15 -> 209 VAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPPCHFNDIIPLTHCPHDVQDMQGYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALAKNPQNKFLGACWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQ
22 -> 326 MAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPPCHFNDIIPLTHCPHDVQDMQGYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCRGGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALAKNPQNKFLGACWMQGEFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNNITDAPWFCGDTTWYWKENFPHSYEAIYGNYQNNVLANIIFVDFQQQGERGLTNAPDEDPDDLSTGYYGSAYRSPENWTTALRSSHFSTAARRGIISDRFVEAILQFWRER
1 -> 21 MNAIISPDYYYVLTVAGQSNA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0001681 - sialate O-acetylesterase activity
GO:0016787 - hydrolase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0019752 - carboxylic acid metabolic process
GO:0006054 - N-acetylneuraminate metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12627N
ECOCYC:
G7919-MONOMER
ECOLIWIKI:
b4309
INTERPRO:
IPR005181
INTERPRO:
IPR036514
PFAM:
PF03629
PRIDE:
P39370
REFSEQ:
NP_418729
SMR:
P39370
UNIPROT:
P39370


Operon      
Name: nanCMS         
Operon arrangement:
Transcription unit        Promoter
nanCM
nanCMS
nanS
yjhA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NagC, NanR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5130 4536578 forward nd [RS-EPT-CBR] [1]
  promoter nanSp1 4537703 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB