RegulonDB RegulonDB 10.7: Gene Form
   

ybdZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entF fes fepE ybdZ fepC

Gene      
Name: ybdZ    Texpresso search in the literature
Synonym(s): ECK0578, G0-10437, b4511
Genome position(nucleotides): 613942 --> 614160 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.71
External database links:  
ASAP:
ABE-0285032
ECHOBASE:
EB4099
PORTECO:
ybdZ
REGULONDB:
b4511
STRING:
511145.b4511
M3D: ybdZ
COLOMBOS: ybdZ
PortEco: ybdZ


Product      
Name: enterobactin biosynthesis protein YbdZ
Synonym(s): MbtH-like protein that enhances the catalytic function of EntF, YbdZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.271
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
4 -> 54 SNPFDDPQGAFYILRNAQGQFSLWPQQCVLPAGWDIVCQPQSQASCQQWLE

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0009239 - enterobactin biosynthetic process
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Boll B., et al., 2011
[2] Felnagle EA., et al., 2010
[3] Miller BR., et al., 2014
External database links:  
ECOCYC:
MONOMER0-2659
ECOLIWIKI:
b4511
INTERPRO:
IPR038020
INTERPRO:
IPR037407
INTERPRO:
IPR005153
PANTHER:
PTHR38444
PDB:
5JA1
PFAM:
PF03621
PRIDE:
P18393
PROTEINMODELPORTAL:
P18393
REFSEQ:
YP_588441
SMART:
SM00923
SMR:
P18393
UNIPROT:
P18393


Operon      
Name: fes-ybdZ-entF-fepE         
Operon arrangement:
Transcription unit        Promoter
fes-ybdZ-entF-fepE


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, FNR
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Boll B., Taubitz T., Heide L., 2011, Role of MbtH-like proteins in the adenylation of tyrosine during aminocoumarin and vancomycin biosynthesis., J Biol Chem 286(42):36281-90

 [2] Felnagle EA., Barkei JJ., Park H., Podevels AM., McMahon MD., Drott DW., Thomas MG., 2010, MbtH-like proteins as integral components of bacterial nonribosomal peptide synthetases., Biochemistry 49(41):8815-7

 [3] Miller BR., Sundlov JA., Drake EJ., Makin TA., Gulick AM., 2014, Analysis of the linker region joining the adenylation and carrier protein domains of the modular nonribosomal peptide synthetases., Proteins 82(10):2691-702


RegulonDB