RegulonDB RegulonDB 10.8: Gene Form
   

cysZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zipA cysK cysZ CysB anti-anti-terminator anti-terminator TSS_2695 TSS_2695 TSS_2694 (cluster) TSS_2694 (cluster) TSS_2693 (cluster) TSS_2693 (cluster) cysKp1 cysKp1 TSS_2691 TSS_2691 cysKp2 cysKp2 TSS_2690 TSS_2690 zipAp9 zipAp9 cysZp1 cysZp1 TSS_2689 TSS_2689

Gene      
Name: cysZ    Texpresso search in the literature
Synonym(s): ECK2408, EG10003, b2413
Genome position(nucleotides): 2531463 --> 2532224 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.13
External database links:  
ASAP:
ABE-0007953
ECHOBASE:
EB0003
OU-MICROARRAY:
b2413
PortEco:
cysZ
STRING:
511145.b2413
COLOMBOS: cysZ


Product      
Name: sulfate:H+ symporter
Synonym(s): CysZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 29.305
Isoelectric point: 9.809
Motif(s):
 
Type Positions Sequence
75 -> 95 LLWPLAVISVLLVFGYFFSTI
222 -> 242 IPLLNLFIMPVAVCGATAMWV
31 -> 51 FVILPLLVNILLMGGAFWWLF
15 -> 231 YFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPTLMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATPPDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMP
151 -> 171 IVLLILYFIPGIGQTVAPVLW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015116 - sulfate transmembrane transporter activity
GO:0009675 - high-affinity sulfate:proton symporter activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0019344 - cysteine biosynthetic process
GO:0000103 - sulfate assimilation
GO:0008272 - sulfate transport
GO:1902600 - proton transmembrane transport
GO:1902358 - sulfate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Assur Sanghai Z., et al., 2018
[2] Parra F., et al., 1983
External database links:  
ECOCYC:
EG10003-MONOMER
ECOLIWIKI:
b2413
INTERPRO:
IPR022985
PFAM:
PF07264
PRIDE:
P0A6J3
PRODB:
PRO_000022390
REFSEQ:
NP_416908
SMR:
P0A6J3
UNIPROT:
P0A6J3


Operon      
Name: cysZ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2689 2530551 reverse nd [RS-EPT-CBR] [3]
  promoter cysZp1 2531383 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter zipAp9 2531407 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2690 2531424 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2691 2532374 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2693 (cluster) 2532385 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2694 (cluster) 2532396 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2695 2533311 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Assur Sanghai Z., Liu Q., Clarke OB., Belcher-Dufrisne M., Wiriyasermkul P., Giese MH., Leal-Pinto E., Kloss B., Tabuso S., Love J., Punta M., Banerjee S., Rajashankar KR., Rost B., Logothetis D., Quick M., Hendrickson WA., Mancia F., 2018, Structure-based analysis of CysZ-mediated cellular uptake of sulfate., Elife 7

 [2] Parra F., Britton P., Castle C., Jones-Mortimer MC., Kornberg HL., 1983, Two separate genes involved in sulphate transport in Escherichia coli K12., J Gen Microbiol 129(2):357-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB