RegulonDB RegulonDB 10.6.3: Gene Form
   

zraS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zraS zraR purD zraP ZraR ZraR CRP terminator anti-terminator anti-anti-terminator zraSp zraSp zraPp zraPp

Gene      
Name: zraS    Texpresso search in the literature
Synonym(s): ECK3995, EG10008, b4003, hydH
Genome position(nucleotides): 4201926 --> 4203323 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.29
External database links:  
ASAP:
ABE-0013088
CGSC:
34249
ECHOBASE:
EB0008
ECOCYC:
EG10008
ECOLIHUB:
zraS
OU-MICROARRAY:
b4003
REGULONDB:
b4003
STRING:
511145.b4003
M3D: zraS
COLOMBOS: zraS
PortEco: b4003


Product      
Name: sensor histidine kinase ZraS
Synonym(s): HydH, ZraS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.032
Isoelectric point: 9.194
Motif(s):
 
Type Positions Sequence
353 -> 456 DPDRLTQVLLNLYLNAIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLDAIFTPYFTTKAEGTGLGLAVVHNIVEQHGGTIQVASQEGKGSTFTLWLPV
383 -> 387 SESGA
254 -> 260 HEIRNPL
202 -> 222 LIILFALATVLLASVLSFFWY
244 -> 306 ALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSELLELVK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
GO:0071284 - cellular response to lead ion
GO:0071294 - cellular response to zinc ion
GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Leonhartsberger S., et al., 2001
[2] Yamamoto K., et al., 2005
External database links:  
DIP:
DIP-9981N
ECOCYC:
HYDH-MONOMER
ECOLIWIKI:
b4003
INTERPRO:
IPR003594
INTERPRO:
IPR029151
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR003661
MODBASE:
P14377
PFAM:
PF00512
PFAM:
PF02518
PRIDE:
P14377
PRINTS:
PR00344
PRODB:
PRO_000024257
PROSITE:
PS50109
PROTEINMODELPORTAL:
P14377
REFSEQ:
NP_418431
SMART:
SM00388
SMART:
SM00387
SMR:
P14377
UNIPROT:
P14377


Operon      
Name: zraSR         
Operon arrangement:
Transcription unit        Promoter
zraSR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ZraR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Leonhartsberger S., Huber A., Lottspeich F., Bock A., 2001, The hydH/G Genes from Escherichia coli code for a zinc and lead responsive two-component regulatory system., J Mol Biol 307(1):93-105

 [2] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56


RegulonDB