RegulonDB RegulonDB 10.8: Gene Form
   

yaaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaaJ yaaA yaaX yaaAp5 yaaAp5 yaaAp3 yaaAp3 TSS_17 TSS_17

Gene      
Name: yaaA    Texpresso search in the literature
Synonym(s): ECK0006, EG10011, b0006
Genome position(nucleotides): 5683 <-- 6459 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.68
External database links:  
ASAP:
ABE-0000018
ECHOBASE:
EB0011
OU-MICROARRAY:
b0006
PortEco:
yaaA
STRING:
511145.b0006
COLOMBOS: yaaA


Product      
Name: peroxide stress resistance protein YaaA
Synonym(s): YaaA, protein that reduces intracellular iron levels under peroxide stress
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.586
Isoelectric point: 7.732
Motif(s):
 
Type Positions Sequence
1 -> 243 MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQISTLMRISDKLAGINAARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQGDNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTKPEQLTGFNSEGYFFDED

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0033194 - response to hydroperoxide
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Gomez-Sagasti MT., et al., 2014
[2] Liu Y., et al., 2011
External database links:  
DIP:
DIP-35783N
ECOCYC:
EG10011-MONOMER
ECOLIWIKI:
b0006
INTERPRO:
IPR005583
MINT:
MINT-1310738
PANTHER:
PTHR30283
PDB:
5CAJ
PFAM:
PF03883
PRIDE:
P0A8I3
REFSEQ:
NP_414547
SMR:
P0A8I3
UNIPROT:
P0A8I3


Operon      
Name: yaaA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_17 6484 reverse nd [RS-EPT-CBR] [3]
  promoter yaaAp3 6587 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yaaAp5 6615 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gomez-Sagasti MT., Becerril JM., Martin I., Epelde L., Garbisu C., 2014, cDNA microarray assessment of early gene expression profiles in Escherichia coli cells exposed to a mixture of heavy metals., Cell Biol Toxicol 30(4):207-32

 [2] Liu Y., Bauer SC., Imlay JA., 2011, The YaaA protein of the Escherichia coli OxyR regulon lessens hydrogen peroxide toxicity by diminishing the amount of intracellular unincorporated iron., J Bacteriol 193(9):2186-96

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB