RegulonDB RegulonDB 10.8: Gene Form
   

add gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malY ydgJ add RbsR terminator anti-terminator anti-anti-terminator TSS_1901 TSS_1901 addp6 addp6

Gene      
Name: add    Texpresso search in the literature
Synonym(s): ECK1618, EG10030, b1623
Genome position(nucleotides): 1702233 --> 1703234 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
Reference(s): [1] Chang ZY., et al., 1991
[2] Jochimsen B., et al., 1975
External database links:  
ASAP:
ABE-0005435
CGSC:
1042
ECHOBASE:
EB0029
MIM:
102700
OU-MICROARRAY:
b1623
PortEco:
add
STRING:
511145.b1623
COLOMBOS: add


Product      
Name: adenosine deaminase
Synonym(s): Add
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.397
Isoelectric point: 5.372
Motif(s):
 
Type Positions Sequence
6 -> 328 LPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSAEEKRALRE
145 -> 145 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0019239 - deaminase activity
GO:0004000 - adenosine deaminase activity
GO:0008270 - zinc ion binding
biological_process GO:0009117 - nucleotide metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0009168 - purine ribonucleoside monophosphate biosynthetic process
GO:0015950 - purine nucleotide interconversion
GO:0032261 - purine nucleotide salvage
GO:0006154 - adenosine catabolic process
GO:0043103 - hypoxanthine salvage
GO:0046101 - hypoxanthine biosynthetic process
GO:0046103 - inosine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9056N
ECOCYC:
ADENODEAMIN-MONOMER
ECOLIWIKI:
b1623
INTERPRO:
IPR006650
INTERPRO:
IPR032466
INTERPRO:
IPR028893
INTERPRO:
IPR006330
INTERPRO:
IPR001365
MINT:
P22333
MODBASE:
P22333
PFAM:
PF00962
PRIDE:
P22333
PROSITE:
PS00485
REFSEQ:
NP_416140
SMR:
P22333
UNIPROT:
P22333


Operon      
Name: add         
Operon arrangement:
Transcription unit        Promoter
add


Transcriptional Regulation      
Display Regulation             
Activated by: RbsR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1901 1702204 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chang ZY., Nygaard P., Chinault AC., Kellems RE., 1991, Deduced amino acid sequence of Escherichia coli adenosine deaminase reveals evolutionarily conserved amino acid residues: implications for catalytic function., Biochemistry 30(8):2273-80

 [2] Jochimsen B., Nygaard P., Vestergaard T., 1975, Location on the chromosome of Escherichia coli of genes governing purine metabolism. Adenosine deaminase (add), guanosine kinase (gsk) and hypoxanthine phosphoribosyltransferase (hpt)., Mol Gen Genet 143(1):85-91

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB