RegulonDB RegulonDB 10.8: Gene Form
   

osmE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nadE osmE chbB spy3\' Fis Fis IHF Fis NagC CRP ChbR ChbR NagC CyaR TSS_2052 TSS_2052 TSS_2051 TSS_2051 TSS_2050 TSS_2050 nadEp nadEp osmEp osmEp TSS_2048 (cluster) TSS_2048 (cluster) TSS_2047 (cluster) TSS_2047 (cluster) chbBp chbBp

Gene      
Name: osmE    Texpresso search in the literature
Synonym(s): ECK1737, EG10044, anr, b1739
Genome position(nucleotides): 1821918 <-- 1822256 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.56
External database links:  
ASAP:
ABE-0005799
CGSC:
36628
ECHOBASE:
EB0042
OU-MICROARRAY:
b1739
PortEco:
osmE
STRING:
511145.b1739
COLOMBOS: osmE


Product      
Name: osmotically-inducible lipoprotein OsmE
Synonym(s): Anr, OsmE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.021
Isoelectric point: 8.039
Motif(s):
 
Type Positions Sequence
21 -> 112 CTAYDRTKDQFVQPVVKDVKKGMSRAQVAQIAGKPSSEVSMIHARGTCQTYILGQRDGKAETYFVALDDTGHVINSGYQTCAEYDTDPQAAK
1 -> 20 MNKNMAGILSAAAVLTMLAG
33 -> 96 QPVVKDVKKGMSRAQVAQIAGKPSSEVSMIHARGTCQTYILGQRDGKAETYFVALDDTGHVINS

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0006970 - response to osmotic stress
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10044-MONOMER
ECOLIWIKI:
b1739
INTERPRO:
IPR037873
INTERPRO:
IPR007450
PFAM:
PF04355
PRIDE:
P0ADB1
PRODB:
PRO_000023469
PROSITE:
PS51257
REFSEQ:
NP_416253
SMR:
P0ADB1
UNIPROT:
P0ADB1


Operon      
Name: osmE         
Operon arrangement:
Transcription unit        Promoter
osmE


Transcriptional Regulation      
Display Regulation             
Repressed by: IHF, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2047 (cluster) 1822275 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2048 (cluster) 1822278 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2050 1822428 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2051 1822436 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2052 1822732 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB