RegulonDB RegulonDB 10.8: Gene Form
   

ansA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sppA ansA pncA terminator anti-anti-terminator anti-terminator TSS_2077 TSS_2077 TSS_2076 TSS_2076 TSS_2075 TSS_2075

Gene      
Name: ansA    Texpresso search in the literature
Synonym(s): ECK1765, EG10045, b1767
Genome position(nucleotides): 1850860 --> 1851876 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.13
External database links:  
ASAP:
ABE-0005886
CGSC:
1030
ECHOBASE:
EB0043
OU-MICROARRAY:
b1767
PortEco:
ansA
STRING:
511145.b1767
COLOMBOS: ansA


Product      
Name: L-asparaginase 1
Synonym(s): AnsA, asparaginase I
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.127
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
61 -> 61 S
162 -> 162 T
4 -> 329 KSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQN
59 -> 61 DSS
240 -> 240 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004067 - asparaginase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006520 - cellular amino acid metabolic process
GO:0006530 - asparagine catabolic process
GO:0033345 - asparagine catabolic process via L-aspartate
External database links:  
DIP:
DIP-9109N
ECOCYC:
ANSA-MONOMER
ECOLIWIKI:
b1767
INTERPRO:
IPR020827
INTERPRO:
IPR041725
INTERPRO:
IPR040919
INTERPRO:
IPR037152
INTERPRO:
IPR036152
INTERPRO:
IPR027475
INTERPRO:
IPR027474
INTERPRO:
IPR027473
INTERPRO:
IPR006034
INTERPRO:
IPR006033
MODBASE:
P0A962
PDB:
2P2D
PDB:
2P2N
PDB:
6NXC
PDB:
2HIM
PDB:
6NXD
PFAM:
PF00710
PFAM:
PF17763
PRIDE:
P0A962
PRINTS:
PR00139
PRODB:
PRO_000022103
PROSITE:
PS51732
PROSITE:
PS00917
PROSITE:
PS00144
REFSEQ:
NP_416281
SMART:
SM00870
SMR:
P0A962
UNIPROT:
P0A962


Operon      
Name: ansA-pncA         
Operon arrangement:
Transcription unit        Promoter
ansA-pncA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2075 1851179 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2076 1851322 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2077 1852392 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB