RegulonDB RegulonDB 10.9: Gene Form
   

ansB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ansB yggM yggN Fis CRP Fis FNR terminator TSS_3283 TSS_3283 ansBp1 ansBp1 ansBp2 ansBp2 yggMp1 yggMp1 yggMp4 yggMp4 yggMp3 yggMp3

Gene      
Name: ansB    Texpresso search in the literature
Synonym(s): ECK2952, EG10046, b2957
Genome position(nucleotides): 3099682 <-- 3100728 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.63
External database links:  
ASAP:
ABE-0009700
CGSC:
30045
ECHOBASE:
EB0044
ECOLIHUB:
ansB
OU-MICROARRAY:
b2957
STRING:
511145.b2957
COLOMBOS: ansB


Product      
Name: L-asparaginase 2
Synonym(s): AnsB, asparaginase II
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 36.851
Isoelectric point: 6.287
Motif(s):
 
Type Positions Sequence
171 -> 171 V
1 -> 22 MEFFKKTALAALVMGFSGAALA
235 -> 345 KVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTGTAVVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIF
274 -> 274 S
23 -> 348 LPNITILATGGTIAGGGDSATKSNYTVGKVGVENLVNAVPQLKDIANVKGEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYFLDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDTPFDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTGTAVVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0032991 - protein-containing complex
molecular_function GO:0016787 - hydrolase activity
GO:0004067 - asparaginase activity
GO:0042802 - identical protein binding
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0006528 - asparagine metabolic process
GO:0006530 - asparagine catabolic process
External database links:  
DIP:
DIP-9110N
ECOCYC:
ANSB-MONOMER
ECOLIWIKI:
b2957
INTERPRO:
IPR027474
INTERPRO:
IPR027473
INTERPRO:
IPR020827
INTERPRO:
IPR004550
INTERPRO:
IPR040919
INTERPRO:
IPR027475
INTERPRO:
IPR036152
INTERPRO:
IPR037152
INTERPRO:
IPR006034
MINT:
P00805
MODBASE:
P00805
PDB:
6PA2
PDB:
6PA3
PDB:
6PA4
PDB:
6PA5
PDB:
6PA6
PDB:
6PA8
PDB:
6PA9
PDB:
6PAA
PDB:
6PAB
PDB:
6PAC
PDB:
6V23
PDB:
6V24
PDB:
6V25
PDB:
6V26
PDB:
6V27
PDB:
6V28
PDB:
6V29
PDB:
6V2A
PDB:
6V2B
PDB:
6V2C
PDB:
6V2G
PDB:
6NXB
PDB:
6NXA
PDB:
6NX9
PDB:
6NX8
PDB:
6NX7
PDB:
6NX6
PDB:
6EOK
PDB:
5MQ5
PDB:
4ECA
PDB:
3ECA
PDB:
1NNS
PDB:
1JJA
PDB:
1JAZ
PDB:
1IHD
PDB:
1HO3
PFAM:
PF17763
PFAM:
PF00710
PRIDE:
P00805
PRINTS:
PR00139
PRODB:
PRO_000022104
PROSITE:
PS00144
PROSITE:
PS00917
PROSITE:
PS51732
REFSEQ:
NP_417432
SMART:
SM00870
SMR:
P00805
UNIPROT:
P00805


Operon      
Name: ansB         
Operon arrangement:
Transcription unit        Promoter
ansB
ansB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yggMp3 3099593 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yggMp4 3099595 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yggMp1 3099757 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3283 3101055 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB