RegulonDB RegulonDB 10.7: Gene Form
   

apaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

apaH rsmA apaG pdxA TSS_86 TSS_86 apaGp apaGp TSS_84 TSS_84 apaHp4 apaHp4

Gene      
Name: apaG    Texpresso search in the literature
Synonym(s): ECK0051, EG10047, b0050
Genome position(nucleotides): 51229 <-- 51606 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.85
External database links:  
ASAP:
ABE-0000169
CGSC:
30310
ECHOBASE:
EB0045
OU-MICROARRAY:
b0050
PORTECO:
apaG
REGULONDB:
b0050
STRING:
511145.b0050
M3D: apaG
COLOMBOS: apaG
PortEco: b0050


Shine dalgarno      
Sequence: cgcgcctttgCAGGAGagttaacGAT


Product      
Name: DUF525 domain-containing protein ApaG
Synonym(s): ApaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 13.867
Isoelectric point: 4.431
Motif(s):
 
Type Positions Sequence
1 -> 125 MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAVPTLIH
18 -> 102 AQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10047-MONOMER
ECOLIWIKI:
b0050
INTERPRO:
IPR023065
INTERPRO:
IPR007474
INTERPRO:
IPR036767
PFAM:
PF04379
PRIDE:
P62672
PROSITE:
PS51087
PROTEINMODELPORTAL:
P62672
REFSEQ:
NP_414592
SMR:
P62672
SWISSMODEL:
P62672
UNIPROT:
P62672


Operon      
Name: lptD-surA-pdxA-rsmA-apaGH         
Operon arrangement:
Transcription unit        Promoter
apaGH
rsmA-apaGH
imp
imp
imp-surA-pdxA
pdxA-rsmA
pdxA-rsmA-apaGH
surA-pdxA-rsmA-apaGH


Transcriptional Regulation      
Display Regulation             
Activated by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter apaHp4 51293 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_84 51998 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_86 52194 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB