RegulonDB RegulonDB 10.8: Gene Form
   

apaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

apaH folA apaG apaHp4 apaHp4

Gene      
Name: apaH    Texpresso search in the literature
Synonym(s): ECK0050, EG10048, b0049, cfcB
Genome position(nucleotides): 50380 <-- 51222 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.75
External database links:  
ASAP:
ABE-0000167
CGSC:
17761
ECHOBASE:
EB0046
OU-MICROARRAY:
b0049
PortEco:
apaH
STRING:
511145.b0049
COLOMBOS: apaH


Product      
Name: diadenosine tetraphosphatase
Synonym(s): ApaH, CfcB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.297
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
4 -> 139 YLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRRQPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDV
83 -> 83 K

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0008796 - bis(5'-nucleosyl)-tetraphosphatase activity
GO:0008803 - bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity
biological_process GO:0010165 - response to X-ray
GO:0110154 - RNA decapping
GO:0015949 - nucleobase-containing small molecule interconversion
Note(s): Note(s): ...[more].
Reference(s): [1] Barton GJ., et al., 1994
[2] Blanchin-Roland S., et al., 1986
[3] Guranowski A. 1990
[4] Guranowski A., et al., 1987
[5] Guranowski A., et al., 1989
[6] Lazewska D., et al., 1990
[7] Nishimura A., et al., 1997
[8] Roa BB., et al., 1989
[9] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-9113N
ECOCYC:
EG10048-MONOMER
ECOLIWIKI:
b0049
INTERPRO:
IPR004843
INTERPRO:
IPR029052
INTERPRO:
IPR004617
MODBASE:
P05637
PANTHER:
PTHR24032:SF49
PFAM:
PF00149
PRIDE:
P05637
PRODB:
PRO_000022106
REFSEQ:
NP_414591
SMR:
P05637
UNIPROT:
P05637


Operon      
Name: lptD-surA-pdxA-rsmA-apaGH         
Operon arrangement:
Transcription unit        Promoter
apaGH
rsmA-apaGH
imp
imp
imp-surA-pdxA
pdxA-rsmA
pdxA-rsmA-apaGH
surA-pdxA-rsmA-apaGH


Transcriptional Regulation      
Display Regulation             
Activated by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter apaHp4 51293 reverse Similarity to the consensus
Read more >
[ICWHO] [10]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Barton GJ., Cohen PT., Barford D., 1994, Conservation analysis and structure prediction of the protein serine/threonine phosphatases. Sequence similarity with diadenosine tetraphosphatase from Escherichia coli suggests homology to the protein phosphatases., Eur J Biochem 220(1):225-37

 [2] Blanchin-Roland S., Blanquet S., Schmitter JM., Fayat G., 1986, The gene for Escherichia coli diadenosine tetraphosphatase is located immediately clockwise to folA and forms an operon with ksgA., Mol Gen Genet 205(3):515-22

 [3] Guranowski A., 1990, Fluoride is a strong and specific inhibitor of (asymmetrical) Ap4A hydrolases., FEBS Lett 262(2):205-8

 [4] Guranowski A., Biryukov A., Tarussova NB., Khomutov RM., Jakubowski H., 1987, Phosphonate analogues of diadenosine 5',5'''-P1,P4-tetraphosphate as substrates or inhibitors of procaryotic and eucaryotic enzymes degrading dinucleoside tetraphosphates., Biochemistry 26(12):3425-9

 [5] Guranowski A., Starzynska E., Taylor GE., Blackburn GM., 1989, Studies on some specific Ap4A-degrading enzymes with the use of various methylene analogues of P1P4-bis-(5',5'''-adenosyl) tetraphosphate., Biochem J 262(1):241-4

 [6] Lazewska D., Guranowski A., 1990, P alpha-chiral phosphorothioate analogues of bis(5'-adenosyl)tetraphosphate (Ap4A); their enzymatic synthesis and degradation., Nucleic Acids Res 18(20):6083-8

 [7] Nishimura A., Moriya S., Ukai H., Nagai K., Wachi M., Yamada Y., 1997, Diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) controls the timing of cell division in Escherichia coli., Genes Cells 2(6):401-13

 [8] Roa BB., Connolly DM., Winkler ME., 1989, Overlap between pdxA and ksgA in the complex pdxA-ksgA-apaG-apaH operon of Escherichia coli K-12., J Bacteriol 171(9):4767-77

 [9] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB