RegulonDB RegulonDB 10.8: Gene Form
   

araA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araB araA araD anti-anti-terminator anti-terminator terminator

Gene      
Name: araA    Texpresso search in the literature
Synonym(s): ECK0063, EG10052, b0062
Genome position(nucleotides): 66835 <-- 68337 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.49
External database links:  
ASAP:
ABE-0000221
CGSC:
1028
ECHOBASE:
EB0050
OU-MICROARRAY:
b0062
PortEco:
araA
STRING:
511145.b0062
COLOMBOS: araA


Product      
Name: L-arabinose isomerase
Synonym(s): AraA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.074
Isoelectric point: 6.547
Motif(s):
 
Type Positions Sequence
5 -> 359 DNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLPCKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFHTQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSWMRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDVNALVDEYESCYTMTPATQIHGKKRQNVLEAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFEKGNDLVLGSHMLEVCPSIA
248 -> 248 K
360 -> 360 A
363 -> 476 KPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDLGDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALNLNDMRQFAEMHDIEITVI
72 -> 72 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
GO:0008733 - L-arabinose isomerase activity
GO:0030145 - manganese ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0005996 - monosaccharide metabolic process
GO:0019568 - arabinose catabolic process
GO:0019569 - L-arabinose catabolic process to xylulose 5-phosphate
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9123N
ECOCYC:
ARABISOM-MONOMER
ECOLIWIKI:
b0062
INTERPRO:
IPR009015
INTERPRO:
IPR038583
INTERPRO:
IPR024664
INTERPRO:
IPR004216
INTERPRO:
IPR003762
MODBASE:
P08202
PANTHER:
PTHR38464
PDB:
2HXG
PDB:
4F2D
PDB:
2AJT
PFAM:
PF02610
PFAM:
PF11762
PRIDE:
P08202
PRODB:
PRO_000022114
PRODOM:
PD018364
REFSEQ:
NP_414604
SMR:
P08202
UNIPROT:
P08202


Operon      
Name: araBAD         
Operon arrangement:
Transcription unit        Promoter
araBAD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, AraC
Repressed by: AraC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB