RegulonDB RegulonDB 10.8: Gene Form
   

araB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araB araA araC AraC XylR AraC XylR AraC CRP AraC AraC terminator araCp araCp araBp araBp

Gene      
Name: araB    Texpresso search in the literature
Synonym(s): ECK0064, EG10053, b0063
Genome position(nucleotides): 68348 <-- 70048 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.02
External database links:  
ASAP:
ABE-0000223
CGSC:
1027
ECHOBASE:
EB0051
MIM:
105400
OU-MICROARRAY:
b0063
PortEco:
araB
STRING:
511145.b0063
COLOMBOS: araB


Product      
Name: ribulokinase
Synonym(s): AraB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 61.089
Isoelectric point: 5.092
Motif(s):
 
Type Positions Sequence
2 -> 566 AIAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCDAPNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLALRPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHVTRQDSAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASFFDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGDIYAWFGRVLGWPLEQLAAQHPELKTQINASQKQLLPALTEAWAKNPSLDHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMALGGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASAVEKTLQPCSEQAQRFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVATL
127 -> 128 EA
350 -> 350 G
525 -> 525 C
403 -> 403 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008741 - ribulokinase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016052 - carbohydrate catabolic process
GO:0016310 - phosphorylation
GO:0019568 - arabinose catabolic process
GO:0019569 - L-arabinose catabolic process to xylulose 5-phosphate
GO:0019572 - L-arabinose catabolic process
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
RIBULOKIN-MONOMER
ECOLIWIKI:
b0063
INTERPRO:
IPR005929
INTERPRO:
IPR018485
MODBASE:
P08204
PANTHER:
PTHR10196:SF45
PFAM:
PF02782
PRIDE:
P08204
PRODB:
PRO_000022115
REFSEQ:
NP_414605
SMR:
P08204
UNIPROT:
P08204


Operon      
Name: araBAD         
Operon arrangement:
Transcription unit        Promoter
araBAD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, AraC
Repressed by: AraC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB