RegulonDB RegulonDB 10.8: Gene Form
   

araC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araB araC yabI AraC XylR AraC XylR AraC CRP AraC AraC terminator yabIp yabIp araCp araCp araBp araBp

Gene      
Name: araC    Texpresso search in the literature
Synonym(s): ECK0065, EG10054, b0064
Genome position(nucleotides): 70387 --> 71265 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0000236
CGSC:
1026
ECHOBASE:
EB0052
OU-MICROARRAY:
b0064
PortEco:
araC
STRING:
511145.b0064
COLOMBOS: araC


Product      
Name: DNA-binding transcriptional dual regulator AraC
Synonym(s): AraC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 33.384
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
7 -> 7 D
200 -> 278 VAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRA
213 -> 213 H
209 -> 209 S
246 -> 269 IATVGRNVGFDDQLYFSRVFKKCT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0019568 - arabinose catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Hendrickson W., et al., 1990
[2] Johnson CM., et al., 1995
External database links:  
DIP:
DIP-9125N
ECOCYC:
PD00242
ECOLIWIKI:
b0064
INTERPRO:
IPR009057
INTERPRO:
IPR037923
INTERPRO:
IPR020449
INTERPRO:
IPR018062
INTERPRO:
IPR018060
INTERPRO:
IPR003313
MODBASE:
P0A9E0
PDB:
2ARC
PDB:
2K9S
PDB:
2AAC
PDB:
2ARA
PDB:
1XJA
PFAM:
PF02311
PFAM:
PF12833
PRIDE:
P0A9E0
PRINTS:
PR00032
PRODB:
PRO_000022116
PROSITE:
PS00041
PROSITE:
PS01124
REFSEQ:
NP_414606
SMART:
SM00342
SMR:
P0A9E0
UNIPROT:
P0A9E0


Operon      
Name: araC         
Operon arrangement:
Transcription unit        Promoter
araC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, AraC
Repressed by: XylR, AraC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hendrickson W., Stoner C., Schleif R., 1990, Characterization of the Escherichia coli araFGH and araJ promoters., J Mol Biol 215(4):497-510

 [2] Johnson CM., Schleif RF., 1995, In vivo induction kinetics of the arabinose promoters in Escherichia coli., J Bacteriol 177(12):3438-42


RegulonDB