RegulonDB RegulonDB 10.7: Gene Form
   

araG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araG araF araH araHp7 araHp7

Gene      
Name: araG    Texpresso search in the literature
Synonym(s): ECK1898, EG10058, b1900
Genome position(nucleotides): 1983555 <-- 1985069 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.28
External database links:  
ASAP:
ABE-0006328
CGSC:
1022
ECHOBASE:
EB0056
OU-MICROARRAY:
b1900
PORTECO:
araG
REGULONDB:
b1900
STRING:
511145.b1900
M3D: araG
COLOMBOS: araG
PortEco: b1900


Product      
Name: arabinose ABC transporter ATP binding subunit
Synonym(s): AraG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 55.018
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence
256 -> 499 YGEERLRLDAVKAPGVRTPISLAVRSGEIVGLFGLVGAGRSELMKGMFGGTQITAGQVYIDQQPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVHSVRDNINISARRKHVLGGCVINNGWEENNADHHIRSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKVILLDEPTRGIDVGAKHEIYNVIYALAAQGVAVLFASSDLPEVLGVADRIVVMREGEIAGELLHEQADERQALSLAMPKV
8 -> 243 LSFRGIGKTFPGVKALTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPTTGSVVINGQEMSFSDTTAALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLLNYEAGLQLKHLGMDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIDNLFRVIRELRKEGRVILYVSHRMEEIFALSDAITVFKDGRYVKTFTDMQQVDHDALVQAMVGR
275 -> 427 ISLAVRSGEIVGLFGLVGAGRSELMKGMFGGTQITAGQVYIDQQPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVHSVRDNINISARRKHVLGGCVINNGWEENNADHHIRSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKVILLDEPT
40 -> 47 GENGAGKS
23 -> 172 LTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPTTGSVVINGQEMSFSDTTAALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLLNYEAGLQLKHLGMDIDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015147 - L-arabinose transmembrane transporter activity
GO:0015612 - L-arabinose-importing ATPase activity
biological_process GO:0008643 - carbohydrate transport
GO:0015751 - arabinose transmembrane transport
GO:0042882 - L-arabinose transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48055N
ECOCYC:
ARAG-MONOMER
ECOLIWIKI:
b1900
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR017917
INTERPRO:
IPR017871
INTERPRO:
IPR003593
MINT:
MINT-1305954
MODBASE:
P0AAF3
PANTHER:
PTHR43790:SF6
PFAM:
PF00005
PRIDE:
P0AAF3
PRODB:
PRO_000022120
PROSITE:
PS51268
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P0AAF3
REFSEQ:
NP_416413
SMART:
SM00382
SMR:
P0AAF3
UNIPROT:
P0AAF3


Operon      
Name: araFGH         
Operon arrangement:
Transcription unit        Promoter
araFGH
araFGH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, AraC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter araHp7 1983560 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB