RegulonDB RegulonDB 10.8: Gene Form
   

araJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sbcC araJ mak sbcD CRP AraC AraC CRP araJp araJp

Gene      
Name: araJ    Texpresso search in the literature
Synonym(s): ECK0390, EG10060, araT, b0396
Genome position(nucleotides): 411297 <-- 412481 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.72
External database links:  
ASAP:
ABE-0001378
CGSC:
29861
ECHOBASE:
EB0058
OU-MICROARRAY:
b0396
PortEco:
araJ
STRING:
511145.b0396
COLOMBOS: araJ


Product      
Name: putative transport protein AraJ
Synonym(s): AraJ, AraJ MFS transporter, AraT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.926
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
8 -> 328 LALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMISYYALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKIIKPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLIAVFNIAVMASVYFWVPDIRDEAKGNLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYVKPYMMFISGFSETAMTFIMMLVGLGMVLGNMLSGRISGRYSPLRIAAVTDFIIVLALLMLFFCGGMKTTSLIFAFICCAGLFALSAPLQILLLQNAKGGELLGAAG
5 -> 27 ILSLALGTFGLGMAEFGIMGVLT
323 -> 342 LLGAAGGQIAFNLGSAVGAY
199 -> 221 PAPWLIFAATMFGNAGVFAWFSY
352 -> 374 LAYNYVALPAALLSFAAMSSLLL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ARAJ-MONOMER
ECOLIWIKI:
b0396
INTERPRO:
IPR020846
INTERPRO:
IPR036259
INTERPRO:
IPR011701
MODBASE:
P23910
PANTHER:
PTHR24003:SF271
PFAM:
PF07690
PRIDE:
P23910
PRODB:
PRO_000022122
PROSITE:
PS50850
REFSEQ:
NP_414930
SMR:
P23910
UNIPROT:
P23910


Operon      
Name: araJ         
Operon arrangement:
Transcription unit        Promoter
araJ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, AraC
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB