RegulonDB RegulonDB 10.8: Gene Form
   

argF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argF xynR ykgS argL ArgR ArgR anti-anti-terminator anti-terminator terminator argFp argFp TSS_470 TSS_470 yagIp1 yagIp1

Gene      
Name: argF    Texpresso search in the literature
Synonym(s): ECK0274, EG10067, b0273
Genome position(nucleotides): 289301 <-- 290305 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.81
External database links:  
ASAP:
ABE-0000939
CGSC:
1016
ECHOBASE:
EB0065
NCBI-GENE:
944844
OU-MICROARRAY:
b0273
PortEco:
argF
STRING:
511145.b0273
COLOMBOS: argF


Product      
Name: CP4-6 prophage; ornithine carbamoyltransferase ArgF
Synonym(s): ArgF, ornithine carbamoyltransferase chain F
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.827
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
7 -> 147 KHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLMTMQE
134 -> 137 HPTQ
121 -> 121 A
2 -> 334 SDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLMTMQEHLPGKAFNEMTLVYAGDARNNMGNSMLEAAALTGLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEAKEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENRMHTIKAVMMATLGE
156 -> 330 EMTLVYAGDARNNMGNSMLEAAALTGLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEAKEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENRMHTIKAVMMA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016597 - amino acid binding
GO:0016743 - carboxyl- or carbamoyltransferase activity
GO:0004585 - ornithine carbamoyltransferase activity
biological_process GO:0019240 - citrulline biosynthetic process
GO:0006520 - cellular amino acid metabolic process
GO:0006526 - arginine biosynthetic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0008652 - cellular amino acid biosynthetic process
GO:0006591 - ornithine metabolic process
GO:0042450 - arginine biosynthetic process via ornithine
External database links:  
ECOCYC:
CHAINF-MONOMER
ECOLIWIKI:
b0273
INTERPRO:
IPR024904
INTERPRO:
IPR006132
INTERPRO:
IPR006131
INTERPRO:
IPR006130
INTERPRO:
IPR036901
INTERPRO:
IPR002292
MODBASE:
P06960
PFAM:
PF02729
PFAM:
PF00185
PRIDE:
P06960
PRINTS:
PR00102
PRINTS:
PR00100
PRODB:
PRO_000022130
PROSITE:
PS00097
REFSEQ:
NP_414807
SMR:
P06960
SWISSMODEL:
P06960
UNIPROT:
P06960


Operon      
Name: argF         
Operon arrangement:
Transcription unit        Promoter
argF


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yagIp1 289192 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_470 290115 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB