RegulonDB RegulonDB 10.8: Gene Form
   

argR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdh argR yhcN ArgR ArgR BtsR BtsR CRP BtsR ArcA TSS_3573 TSS_3573 yhcNp6 yhcNp6 yhcNp5 yhcNp5 argRp1 argRp1 argRp2 argRp2 TSS_3572 TSS_3572 mdhp2 mdhp2 TSS_3571 TSS_3571 mdhp1 mdhp1 TSS_3570 (cluster) TSS_3570 (cluster) TSS_3569 TSS_3569

Gene      
Name: argR    Texpresso search in the literature
Synonym(s): ECK3226, EG10070, Rarg, b3237, xerA
Genome position(nucleotides): 3384703 --> 3385173 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.62
External database links:  
ASAP:
ABE-0010620
CGSC:
1011
ECHOBASE:
EB0068
OU-MICROARRAY:
b3237
PortEco:
argR
STRING:
511145.b3237
COLOMBOS: argR


Product      
Name: DNA-binding transcriptional dual regulator ArgR
Synonym(s): ArgR, XerA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: ArgR
Cellular location: cytosol
Molecular weight: 16.994
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
82 -> 148 LKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAI
5 -> 74 AKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELG
44 -> 44 S
47 -> 47 S
76 -> 76 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005667 - transcription factor complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
GO:0034618 - arginine binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:1900079 - regulation of arginine biosynthetic process
GO:1900081 - regulation of arginine catabolic process
GO:0006310 - DNA recombination
GO:0006355 - regulation of transcription, DNA-templated
GO:0006525 - arginine metabolic process
GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0051259 - protein complex oligomerization
GO:0042150 - plasmid recombination
GO:2000143 - negative regulation of DNA-templated transcription, initiation
GO:2000144 - positive regulation of DNA-templated transcription, initiation
Reference(s): [1] Krzyzek R., et al., 1972
[2] Lim DB., et al., 1987
[3] Stirling CJ., et al., 1988
[4] Tian G., et al., 1994
External database links:  
DIP:
DIP-47999N
ECOCYC:
PD00194
ECOLIWIKI:
b3237
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR036251
INTERPRO:
IPR020900
INTERPRO:
IPR020899
INTERPRO:
IPR001669
MINT:
MINT-1252219
MODBASE:
P0A6D0
PANTHER:
PTHR34471
PDB:
1XXA
PDB:
1XXB
PDB:
1XXC
PDB:
1AOY
PFAM:
PF02863
PFAM:
PF01316
PRIDE:
P0A6D0
PRINTS:
PR01467
PRODB:
PRO_000022134
PRODOM:
PD007402
REFSEQ:
NP_417704
SMR:
P0A6D0
UNIPROT:
P0A6D0


Operon      
Name: argR         
Operon arrangement:
Transcription unit        Promoter
argR
argR


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Regulation by small RNA    
  Display Regulation
small RNA dsrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3569 3384285 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3570 (cluster) 3384294 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_3571 3384314 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3572 3384472 reverse nd [RS-EPT-CBR] [5]
  promoter yhcNp5 3385406 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yhcNp6 3385481 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_3573 3385482 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Krzyzek R., Rogers P., 1972, Arginine control of transcription of argECBH messenger ribonucleic acid in Escherichia coli., J Bacteriol 110(3):945-54

 [2] Lim DB., Oppenheim JD., Eckhardt T., Maas WK., 1987, Nucleotide sequence of the argR gene of Escherichia coli K-12 and isolation of its product, the arginine repressor., Proc Natl Acad Sci U S A 84(19):6697-701

 [3] Stirling CJ., Szatmari G., Stewart G., Smith MC., Sherratt DJ., 1988, The arginine repressor is essential for plasmid-stabilizing site-specific recombination at the ColE1 cer locus., EMBO J 7(13):4389-95

 [4] Tian G., Maas WK., 1994, Mutational analysis of the arginine repressor of Escherichia coli., Mol Microbiol 13(4):599-608

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB