RegulonDB RegulonDB 10.8: Gene Form
   

argS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argS yecM yecV RcsB-BglJ ppGpp terminator terminator anti-terminator anti-anti-terminator TSS_2224 TSS_2224 argSp argSp yecMp2 yecMp2 TSS_2223 TSS_2223 yecMp3 yecMp3

Gene      
Name: argS    Texpresso search in the literature
Synonym(s): ECK1877, EG10071, b1876, lov, lov-1
Genome position(nucleotides): 1960062 --> 1961795 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.29
External database links:  
ASAP:
ABE-0006264
CGSC:
1010
ECHOBASE:
EB0069
MIM:
616140
OU-MICROARRAY:
b1876
PortEco:
argS
STRING:
511145.b1876
COLOMBOS: argS


Product      
Name: arginine—tRNA ligase
Synonym(s): ArgRS, ArgS, Lov
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 64.683
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
95 -> 446 HVQQALASDRLGVATPEKQTIVVDYSAPNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANHVGDWGTQFGMLIAWLEKQQQENAGEMELADLEGFYRDAKKHYDEDEEFAERARNYVVKLQSGDEYFREMWRKLVDITMTQNQITYDRLNVTLTRDDVMGESLYNPMLPGIVADLKAKGLAVESEGATVVFLDEFKNKEGEPMGVIIQKKDGGYLYTTTDIACAKYRYETLHADRVLYYIDSRQHQHLMQAWAIVRKAGYVPESVPLEHHMFGMMLGKDGKPFKTRAGGTVKLADLLDEALERARRLVAEKNPDMPADELEKLANAVGIGAVKYADLSKNRTTDYIFDW
460 -> 577 MQYAYTRVLSVFRKAEIDEEQLAAAPVIIREDREAQLAARLLQFEETLTVVAREGTPHVMCAYLYDLAGLFSGFYEHCPILSAENEEVRNSRLKLAQLTAKTLKLGLDTLGIETVERM
122 -> 132 PNVAKEMHVGH
7 -> 87 LSEKVRQAMIAAGAPADCEPQVRQSAKVQFGDYQANGMMAVAKKLGMAPRQLAEQVLTHLDLNGIASKVEIAGPGFINIFL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004814 - arginine-tRNA ligase activity
biological_process GO:0006412 - translation
GO:0006418 - tRNA aminoacylation for protein translation
GO:0006420 - arginyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Airas RK. 1996
[2] Charlier J. 1976
[3] Cheng XD., et al., 1991
[4] Cooper PH., et al., 1969
[5] Faanes R., et al., 1972
[6] Gerlo E., et al., 1982
[7] Hirshfield IN., et al., 1968
[8] Jakubowski H. 1995
[9] Liu MF., et al., 2000
[10] Liu MF., et al., 2001
[11] Liu W., et al., 2002
[12] Liu W., et al., 1999
[13] Lui M., et al., 1978
[14] Mehler AH., et al., 1967
[15] Mitra SK., et al., 1967
[16] Neidhardt FC., et al., 1977
[17] Reeh S., et al., 1977
[18] Wu JF., et al., 1998
[19] Yem DW., et al., 1971
[20] Zhang QS., et al., 1999
External database links:  
DIP:
DIP-9147N
ECOCYC:
ARGS-MONOMER
ECOLIWIKI:
b1876
INTERPRO:
IPR001412
INTERPRO:
IPR036695
INTERPRO:
IPR035684
INTERPRO:
IPR014729
INTERPRO:
IPR009080
INTERPRO:
IPR008909
INTERPRO:
IPR005148
INTERPRO:
IPR001278
MINT:
MINT-1241236
MODBASE:
P11875
PANTHER:
PTHR11956
PDB:
5YYN
PDB:
5YYM
PDB:
4OBY
PDB:
5B63
PFAM:
PF03485
PFAM:
PF00750
PFAM:
PF05746
PRIDE:
P11875
PRINTS:
PR01038
PRODB:
PRO_000022135
PROSITE:
PS00178
REFSEQ:
NP_416390
SMART:
SM00836
SMART:
SM01016
SMR:
P11875
UNIPROT:
P11875


Operon      
Name: argS         
Operon arrangement:
Transcription unit        Promoter
argS


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yecMp3 1959872 reverse Similarity to the consensus
Read more >
[ICWHO] [21]
  promoter TSS_2223 1959873 reverse nd [RS-EPT-CBR] [22]
  promoter yecMp2 1959984 reverse Similarity to the consensus
Read more >
[ICWHO] [21]
  promoter TSS_2224 1961626 forward nd [RS-EPT-CBR] [22]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Airas RK., 1996, Differences in the magnesium dependences of the class I and class II aminoacyl-tRNA synthetases from Escherichia coli., Eur J Biochem 240(1):223-31

 [2] Charlier J., 1976, On the behaviour of arginyl-tRNA synthetase of Escherichia coli in the presence of arginine precursors., Arch Int Physiol Biochim 84(3):588-90

 [3] Cheng XD., Lin SX., Shi JP., Wang YL., 1991, Arginyl-tRNA synthetase from Escherichia coli affinity labeling with 3'-oxidized tRNA(Arg)., Sci China B 34(3):297-305

 [4] Cooper PH., Hirshfield IN., Maas WK., 1969, Map location of arginyl-tRNA synthetase mutations in Escherichia coli K-12., Mol Gen Genet 104(4):383-90

 [5] Faanes R., Rogers P., 1972, Repression of enzymes of arginine biosynthesis by L-canavanine in arginyl-transfer ribonucleic acid synthetase mutants of Escherichia coli., J Bacteriol 112(1):102-13

 [6] Gerlo E., Freist W., Charlier J., 1982, Arginyl-tRNA synthetase from Escherichia coli K12: specificity with regard to ATP analogs and their magnesium complexes., Hoppe Seylers Z Physiol Chem 363(4):365-73

 [7] Hirshfield IN., Horn PC., Hopwood DA., Maas WK., DeDeken R., 1968, Studies on the mechanism of repression of arginine biosynthesis in Escherichia coli. 3. Repression of enzymes of arginine biosynthesis in arginyl-tRNA synthetase mutants., J Mol Biol 35(1):83-93

 [8] Jakubowski H., 1995, Synthesis of cysteine-containing dipeptides by aminoacyl-tRNA synthetases., Nucleic Acids Res 23(22):4608-15

 [9] Liu MF., Li T., Yin ZB., Xu MG., Wang ED., Wang YL., 2000, A Strong Promoter Provided with the Gene Encoding Arginyl-tRNA Synthetase(argS) from Escherichia coli., Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai) 32(5):435-440

 [10] Liu MF., Xu MG., Xia X., Wang ED., Wang YL., 2001, A Negative Element Located in the Upstream Flanking Region of the Gene Encoding Arginyl-tRNA Synthetase (argS) from Escherichia coli., Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai) 33(6):621-628

 [11] Liu W., Liu MF., Xia X., Wang ED., Wang YL., 2002, The effect of N-terminal changes on arginyl-tRNA synthetase from Escherichia coli., Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai) 34(2):131-7

 [12] Liu W., Wang ED., Wang YL., 1999, A Novel System for Hyper Expression and Rapid Purification of Arginyl-tRNA Synthetase from Escherichia coli., Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai) 31(5):494-498

 [13] Lui M., Chakraburtty K., Mehler AH., 1978, Partial reactions of aminoacyl-tRNA synthetases as functions of pH., J Biol Chem 253(22):8061-4

 [14] Mehler AH., Mitra SK., 1967, The activation of arginyl transfer ribonucleic acid synthetase by transfer ribonucleic acid., J Biol Chem 242(23):5495-9

 [15] Mitra SK., Mehler AH., 1967, The arginyl transfer ribonucleic acid synthetase of Escherichia coli., J Biol Chem 242(23):5490-4

 [16] Neidhardt FC., Bloch PL., Pedersen S., Reeh S., 1977, Chemical measurement of steady-state levels of ten aminoacyl-transfer ribonucleic acid synthetases in Escherichia coli., J Bacteriol 129(1):378-87

 [17] Reeh S., Pedersen S., Neidhardt FC., 1977, Transient rates of synthesis of five amionacyl-transfer ribonucleic acid synthetases during a shift-up of Escherichia coli., J Bacteriol 129(2):702-6

 [18] Wu JF., Xia X., Wang ED., Wang YL., 1998, Study on the Overexpression of the Gene Encoding Arginyl-tRNA Synthetase under Induction., Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai) 30(3):236-240

 [19] Yem DW., Williams LS., 1971, Inhibition of arginyl-transfer ribonucleic acid synthetase activity of Escherichia coli by arginine biosynthetic precursors., J Bacteriol 107(2):589-91

 [20] Zhang QS., Shen L., Wang ED., Wang YL., 1999, Biosynthesis and characterization of 4-fluorotryptophan-labeled Escherichia coli arginyl-tRNA synthetase., J Protein Chem 18(2):187-92

 [21] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [22] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB