RegulonDB RegulonDB 10.7: Gene Form
   

ascG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ascF ascG hydN AscG AscG CRP Cra anti-anti-terminator anti-terminator terminator terminator ascBp ascBp ascFp ascFp TSS_3020 TSS_3020 ascGp ascGp hydNp hydNp hypFp3 hypFp3 hypFp2 hypFp2

Gene      
Name: ascG    Texpresso search in the literature
Synonym(s): ECK2709, EG10087, b2714, sac
Genome position(nucleotides): 2838254 <-- 2839264 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.21
External database links:  
ASAP:
ABE-0008922
CGSC:
33230
ECHOBASE:
EB0085
OU-MICROARRAY:
b2714
PORTECO:
ascG
REGULONDB:
b2714
STRING:
511145.b2714
M3D: ascG
COLOMBOS: ascG
PortEco: b2714


Product      
Name: DNA-binding transcriptional repressor AscG
Synonym(s): AscG, Sac
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 36.813
Isoelectric point: 6.605
Motif(s):
 
Type Positions Sequence
207 -> 230 QHGIALNEKLIANGKWTPASGAEG
3 -> 48 TMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVEESGYRPN
4 -> 23 MLEVAKRAGVSKATVSRVLS
171 -> 330 VAELINAGHQEIAFLTGSMDSPTSIERLAGYKDALAQHGIALNEKLIANGKWTPASGAEGVEMLLERGAKFSALVASNDDMAIGAMKALHERGVAVPEQVSVIGFDDIAIAPYTVPALSSVKIPVTEMIQEIIGRLIFMLDGGDFSPPKTFSGKLIRRDS
2 -> 56 TTMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAVEESGYRPNLLARNLSA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
Reference(s): [1] Hall BG., et al., 1992
[2] Ishida Y., et al., 2009
External database links:  
ECOCYC:
EG10087-MONOMER
ECOLIWIKI:
b2714
INTERPRO:
IPR000843
INTERPRO:
IPR010982
INTERPRO:
IPR028082
MODBASE:
P24242
PDB:
3BRQ
PDB:
3DBI
PFAM:
PF00356
PRIDE:
P24242
PRODB:
PRO_000022163
PROSITE:
PS00356
PROSITE:
PS50932
PROTEINMODELPORTAL:
P24242
REFSEQ:
NP_417194
SMART:
SM00354
SMR:
P24242
UNIPROT:
P24242


Operon      
Name: ascG         
Operon arrangement:
Transcription unit        Promoter
ascG


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ascGp 2839287 reverse nd [AIPP] [1]
  promoter TSS_3020 2839288 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hall BG., Xu L., 1992, Nucleotide sequence, function, activation, and evolution of the cryptic asc operon of Escherichia coli K12., Mol Biol Evol 9(4):688-706

 [2] Ishida Y., Kori A., Ishihama A., 2009, Participation of regulator AscG of the beta-glucoside utilization operon in regulation of the propionate catabolism operon., J Bacteriol 191(19):6136-44

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB