RegulonDB RegulonDB 10.7: Gene Form
   

asnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

asnB umpH metT Fis ppGpp asnBp asnBp metTp metTp

Gene      
Name: asnB    Texpresso search in the literature
Synonym(s): ECK0662, EG10092, b0674
Genome position(nucleotides): 697513 <-- 699177 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.13
Reference(s): [1] Scofield MA., et al., 1990
External database links:  
ASAP:
ABE-0002292
CGSC:
994
ECHOBASE:
EB0090
MIM:
615574
OU-MICROARRAY:
b0674
PORTECO:
asnB
REGULONDB:
b0674
STRING:
511145.b0674
M3D: asnB
COLOMBOS: asnB
PortEco: b0674


Product      
Name: asparagine synthetase B
Synonym(s): AsnB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 62.659
Isoelectric point: 5.703
Motif(s):
 
Type Positions Sequence
34 -> 34 D
2 -> 554 CSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK
50 -> 54 RLSIV
211 -> 366 ELRQALEDSVKSHLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLYFHKAPN
349 -> 349 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.6 - asparagine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0016597 - amino acid binding
GO:0004066 - asparagine synthase (glutamine-hydrolyzing) activity
GO:0004071 - aspartate-ammonia ligase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006529 - asparagine biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009063 - cellular amino acid catabolic process
GO:0070981 - L-asparagine biosynthetic process
External database links:  
DIP:
DIP-9177N
ECOCYC:
ASNSYNB-MONOMER
ECOLIWIKI:
b0674
INTERPRO:
IPR001962
INTERPRO:
IPR029055
INTERPRO:
IPR033738
INTERPRO:
IPR006426
INTERPRO:
IPR014729
INTERPRO:
IPR017932
MINT:
MINT-1306603
MODBASE:
P22106
PDB:
1CT9
PFAM:
PF00733
PFAM:
PF13537
PRIDE:
P22106
PRODB:
PRO_000022168
PROSITE:
PS51278
PROTEINMODELPORTAL:
P22106
REFSEQ:
NP_415200
SMR:
P22106
UNIPROT:
P22106


Operon      
Name: asnB         
Operon arrangement:
Transcription unit        Promoter
asnB


Transcriptional Regulation      
Display Regulation             
Activated by: GadX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Scofield MA., Lewis WS., Schuster SM., 1990, Nucleotide sequence of Escherichia coli asnB and deduced amino acid sequence of asparagine synthetase B., J Biol Chem 265(22):12895-902


RegulonDB