RegulonDB RegulonDB 10.8: Gene Form
   

asnC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

asnA asnC mioC AsnC Nac AsnC AsnC Nac AsnC Nac MraZ MraZ MraZ ppGpp anti-anti-terminator anti-terminator terminator terminator TSS_4352 TSS_4352 TSS_4351 TSS_4351 TSS_4350 TSS_4350 TSS_4349 (cluster) TSS_4349 (cluster) asnAp asnAp asnCp asnCp mioCp mioCp

Gene      
Name: asnC    Texpresso search in the literature
Synonym(s): ECK3737, EG10093, b3743
Genome position(nucleotides): 3926545 <-- 3927003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.46
External database links:  
ASAP:
ABE-0012237
CGSC:
18520
ECHOBASE:
EB0091
OU-MICROARRAY:
b3743
PortEco:
asnC
STRING:
511145.b3743
COLOMBOS: asnC


Product      
Name: DNA-binding transcriptional dual regulator AsnC
Synonym(s): AsnC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AsnC
Cellular location: cytosol
Molecular weight: 16.888
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
76 -> 143 LKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQ
6 -> 67 IDNLDRGILEALMGNARTAYAELAKQFGVSPGTIHVRVEKMKQAGIITGARIDVSPKQLGYD
7 -> 53 DNLDRGILEALMGNARTAYAELAKQFGVSPGTIHVRVEKMKQAGIIT
25 -> 44 YAELAKQFGVSPGTIHVRVE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.6 - asparagine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0016597 - amino acid binding
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0043200 - response to amino acid
Reference(s): [1] Buhk HJ., et al., 1983
[2] Burland V., et al., 1993
External database links:  
DIP:
DIP-9178N
ECOCYC:
PD00250
ECOLIWIKI:
b3743
INTERPRO:
IPR011008
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR019888
INTERPRO:
IPR019887
INTERPRO:
IPR019885
INTERPRO:
IPR011991
INTERPRO:
IPR000485
MODBASE:
P0ACI6
PDB:
2CG4
PFAM:
PF01037
PRIDE:
P0ACI6
PRINTS:
PR00033
PRODB:
PRO_000022169
PROSITE:
PS50956
PROSITE:
PS00519
REFSEQ:
NP_418199
SMART:
SM00344
SMR:
P0ACI6
SWISSMODEL:
P0ACI6
UNIPROT:
P0ACI6


Operon      
Name: asnC-mioC-mnmG-rsmG         
Operon arrangement:
Transcription unit        Promoter
mnmG-rsmG
mioC
asnC
asnC-mioC
asnC-mioC-mnmG
rsmG


Transcriptional Regulation      
Display Regulation             
Repressed by: Nac, AsnC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4349 (cluster) 3927131 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4350 3927138 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4351 3927155 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4352 3927521 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Buhk HJ., Messer W., 1983, The replication origin region of Escherichia coli: nucleotide sequence and functional units., Gene 24(2-3):265-79

 [2] Burland V., Plunkett G., Daniels DL., Blattner FR., 1993, DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication., Genomics 16(3):551-61

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB