RegulonDB RegulonDB 10.7: Gene Form
   

asnS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

asnS pncB ompF CpxR CpxR OmpR IHF CRP IHF CpxR RstA CRP OmpR OmpR CpxR IHF CRP OmpR MicF anti-anti-terminator anti-terminator terminator TSS_1241 TSS_1241 asnSp asnSp TSS_1239 (cluster) TSS_1239 (cluster) TSS_1238 TSS_1238 TSS_1237 (cluster) TSS_1237 (cluster) TSS_1236 TSS_1236 TSS_1235 TSS_1235 TSS_1234 TSS_1234 TSS_1233 TSS_1233 TSS_1232 TSS_1232 TSS_1231 TSS_1231 ompFp ompFp TSS_1229 TSS_1229 TSS_1228 TSS_1228 TSS_1227 TSS_1227 TSS_1226 (cluster) TSS_1226 (cluster) TSS_1225 (cluster) TSS_1225 (cluster) TSS_1224 TSS_1224 TSS_1223 TSS_1223 TSS_1222 TSS_1222 TSS_1221 TSS_1221 TSS_1220 TSS_1220 TSS_1219 (cluster) TSS_1219 (cluster) TSS_1218 TSS_1218 TSS_1217 TSS_1217 TSS_1216 TSS_1216 TSS_1215 (cluster) TSS_1215 (cluster) TSS_1214 TSS_1214 TSS_1213 TSS_1213

Gene      
Name: asnS    Texpresso search in the literature
Synonym(s): ECK0921, EG10094, b0930, lcs, tss
Genome position(nucleotides): 987585 <-- 988985 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.39
External database links:  
ASAP:
ABE-0003162
CGSC:
993
ECHOBASE:
EB0092
MIM:
256000
MIM:
616239
OU-MICROARRAY:
b0930
PORTECO:
asnS
REGULONDB:
b0930
STRING:
511145.b0930
M3D: asnS
COLOMBOS: asnS
PortEco: b0930


Product      
Name: asparagine—tRNA ligase
Synonym(s): AsnRS, AsnS, Lcs, Tss
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.57
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
20 -> 99 VTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPNYNEDVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEV
426 -> 426 Y
119 -> 460 EYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITASDTEGAGEMFRVSTLDLENLPRNDQGKVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGLAEAMLKYVFKAVLEERADDMKFFAERVDKDAVSRLERFIEADFAQVDYTDAVTILENCGRKFENPVYWGVDLSSEHERYLAEEHFKAPVVVKNYPKDIKAFYMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDERMLEMGLNKEDYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRT
231 -> 231 P
2 -> 466 SVVPVADVLQGRVAVDSEVTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPNYNEDVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTYPMAAKRHSIEYLREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITASDTEGAGEMFRVSTLDLENLPRNDQGKVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNTSRHLAEFWMLEPEVAFANLNDIAGLAEAMLKYVFKAVLEERADDMKFFAERVDKDAVSRLERFIEADFAQVDYTDAVTILENCGRKFENPVYWGVDLSSEHERYLAEEHFKAPVVVKNYPKDIKAFYMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDERMLEMGLNKEDYWWYRDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTPRNASF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0004816 - asparagine-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006412 - translation
GO:0006418 - tRNA aminoacylation for protein translation
GO:0006421 - asparaginyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Ganoza MC., et al., 1993
[2] Masuda Y., et al., 1993
[3] Mutoh N., et al., 1981
External database links:  
DIP:
DIP-9179N
ECOCYC:
ASNS-MONOMER
ECOLIWIKI:
b0930
INTERPRO:
IPR004364
INTERPRO:
IPR004365
INTERPRO:
IPR002312
INTERPRO:
IPR004522
INTERPRO:
IPR012340
INTERPRO:
IPR006195
MINT:
MINT-1319001
PANTHER:
PTHR22594
PFAM:
PF01336
PFAM:
PF00152
PRIDE:
P0A8M0
PRINTS:
PR01042
PRODB:
PRO_000022170
PROSITE:
PS50862
PROTEINMODELPORTAL:
P0A8M0
REFSEQ:
NP_415450
SMR:
P0A8M0
UNIPROT:
P0A8M0


Operon      
Name: asnS         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1213 985982 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1214 985984 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1215 (cluster) 985988 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1216 986008 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1217 986010 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1218 986077 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1219 (cluster) 986081 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1220 986084 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1221 986119 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1222 986124 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1223 986314 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1224 986647 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1225 (cluster) 986768 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1226 (cluster) 986786 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1227 986788 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1228 986897 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1229 986969 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1231 988306 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1232 988310 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1233 988988 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1234 988990 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1235 988995 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1236 988999 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1237 (cluster) 989003 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1238 989005 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1239 (cluster) 989020 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1241 989614 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ganoza MC., Aoki H., Kozieradzki I., Schwartz I., 1993, Reconstruction of translation. Evidence for the involvement of the rescue protein in the association/dissociation of ribosomal subunits., Eur J Biochem 217(3):839-47

 [2] Masuda Y., Tsuchimoto S., Nishimura A., Ohtsubo E., 1993, Isolation of temperature-sensitive aminoacyl-tRNA synthetase mutants from an Escherichia coli strain harboring the pemK plasmid., Mol Gen Genet 238(1-2):169-76

 [3] Mutoh N., Nagasawa T., Mizushima S., 1981, Specialized transducing bacteriophage lambda carrying the structural gene for a major outer membrane matrix protein of Escherichia coli K-12., J Bacteriol 145(2):1085-90

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB