RegulonDB RegulonDB 10.5: Gene Form
   

atpG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpA atpD atpG TSS_4321 (cluster) TSS_4321 (cluster) TSS_4320 TSS_4320 TSS_4319 TSS_4319 TSS_4318 TSS_4318 TSS_4317 TSS_4317 TSS_4316 TSS_4316 TSS_4315 TSS_4315 TSS_4314 TSS_4314 TSS_4313 TSS_4313 TSS_4312 TSS_4312 TSS_4311 TSS_4311 TSS_4310 (cluster) TSS_4310 (cluster) TSS_4309 TSS_4309 TSS_4308 TSS_4308 TSS_4307 TSS_4307 TSS_4306 TSS_4306 TSS_4305 (cluster) TSS_4305 (cluster) TSS_4304 (cluster) TSS_4304 (cluster) TSS_4303 TSS_4303 TSS_4302 TSS_4302 TSS_4301 (cluster) TSS_4301 (cluster) TSS_4300 TSS_4300 TSS_4299 (cluster) TSS_4299 (cluster) TSS_4298 TSS_4298 TSS_4297 TSS_4297 TSS_4296 TSS_4296 TSS_4295 TSS_4295 TSS_4294 TSS_4294 atpCp1 atpCp1

Gene      
Name: atpG    Texpresso search in the literature
Synonym(s): ECK3726, EG10104, b3733, papC, uncG
Genome position(nucleotides): 3917402 <-- 3918265 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
11.11
External database links:  
ASAP:
ABE-0012211
CGSC:
27
ECHOBASE:
EB0102
ECOGENE:
EG10104
ECOLIHUB:
atpG
OU-MICROARRAY:
b3733
REGULONDB:
b3733
STRING:
511145.b3733
M3D: atpG
COLOMBOS: atpG
PortEco: b3733


Product      
Name: ATP synthase F1 complex subunit γ
Synonym(s): ATP synthase F1 complex - gamma subunit, AtpG, PapC, UncG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.577
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence
5 -> 286 KEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDDDLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGAAA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0045261 - proton-transporting ATP synthase complex, catalytic core F(1)
molecular_function GO:0005515 - protein binding
GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 - proton-transporting ATPase activity, rotational mechanism
biological_process GO:0099132 - ATP hydrolysis coupled cation transmembrane transport
GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0015986 - ATP synthesis coupled proton transport
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jahn LJ., et al., 2017
External database links:  
DIP:
DIP-35938N
ECOCYC:
ATPG-MONOMER
ECOLIWIKI:
b3733
ENZYME-DB:
3.6.3.14
INTERPRO:
IPR023632
INTERPRO:
IPR000131
MODBASE:
P0ABA6
PANTHER:
PTHR11693
PDB:
5T4Q
PDB:
5T4O
PDB:
3OAA
PDB:
1FS0
PDB:
1D8S
PDB:
5T4P
PFAM:
PF00231
PRIDE:
P0ABA6
PRINTS:
PR00126
PRODB:
PRO_000022192
PROSITE:
PS00153
PROTEINMODELPORTAL:
P0ABA6
REFSEQ:
NP_418189
SMR:
P0ABA6
UNIPROT:
P0ABA6


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter atpCp1 3916059 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4294 3916641 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4295 3916759 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4296 3916978 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4297 3917001 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4298 3917107 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4299 (cluster) 3917272 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4300 3917275 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4301 (cluster) 3917397 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4302 3917446 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4303 3917736 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4304 (cluster) 3917740 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4305 (cluster) 3917744 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4306 3917765 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4307 3918078 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4308 3918597 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4309 3918988 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4310 (cluster) 3919083 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4311 3919085 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4312 3919114 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4313 3919282 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4314 3919287 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4315 3919409 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4316 3919427 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4317 3919430 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4318 3919444 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4319 3919510 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4320 3919515 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4321 (cluster) 3919763 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB