RegulonDB RegulonDB 10.6.3: Gene Form
   

betA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

betA betB ykgH betAp5 betAp5 betAp7 betAp7

Gene      
Name: betA    Texpresso search in the literature
Synonym(s): ECK0309, EG10109, b0311
Genome position(nucleotides): 325577 <-- 327247 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.09
External database links:  
ASAP:
ABE-0001070
CGSC:
17740
ECHOBASE:
EB0107
ECOCYC:
EG10109
ECOLIHUB:
betA
OU-MICROARRAY:
b0311
REGULONDB:
b0311
STRING:
511145.b0311
M3D: betA
COLOMBOS: betA
PortEco: b0311


Product      
Name: choline dehydrogenase
Synonym(s): BetA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 61.878
Isoelectric point: 5.474
Motif(s):
 
Type Positions Sequence
3 -> 300 FDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRTQMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNALDLDNWAQEPGLENWSYLDCLPYYRKAETRDMGENDYHGGDGPVSVTTSKPGVNPLFEAMIEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMTDHIIFDGKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEFDIPLVHELPGVGENLQDHL
393 -> 527 SRGHVRIKSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGVECQTDEQLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLNATTIMIGEKI
4 -> 33 DYIIIGAGSAGNVLATRLTEDPNTSVLLLE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.18 - betaine biosynthesis
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016491 - oxidoreductase activity
GO:0016614 - oxidoreductase activity, acting on CH-OH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0008802 - betaine-aldehyde dehydrogenase activity
GO:0008812 - choline dehydrogenase activity
biological_process GO:0006970 - response to osmotic stress
GO:0019285 - glycine betaine biosynthetic process from choline
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CHD-MONOMER
ECOLIWIKI:
b0311
INTERPRO:
IPR027424
INTERPRO:
IPR036188
INTERPRO:
IPR012132
INTERPRO:
IPR011533
INTERPRO:
IPR007867
INTERPRO:
IPR000172
MODBASE:
P17444
PANTHER:
PTHR11552:SF157
PFAM:
PF00732
PFAM:
PF05199
PRIDE:
P17444
PRODB:
PRO_000022207
PROSITE:
PS00623
PROSITE:
PS00624
PROTEINMODELPORTAL:
P17444
REFSEQ:
NP_414845
SMR:
P17444
UNIPROT:
P17444


Operon      
Name: betIBA         
Operon arrangement:
Transcription unit        Promoter
betIBA


Transcriptional Regulation      
Display Regulation             
Activated by: Cra
Repressed by: BetI, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter betAp7 327257 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter betAp5 327261 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB