RegulonDB RegulonDB 10.6.3: Gene Form
   

betI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

betT betB betI ArcA ArcA BetI ArcA betTp betTp betIp betIp betAp5 betAp5

Gene      
Name: betI    Texpresso search in the literature
Synonym(s): ECK0311, EG10111, b0313
Genome position(nucleotides): 328747 <-- 329334 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.8
External database links:  
ASAP:
ABE-0001076
CGSC:
30692
ECHOBASE:
EB0109
ECOCYC:
EG10111
ECOLIHUB:
betI
OU-MICROARRAY:
b0313
REGULONDB:
b0313
STRING:
511145.b0313
M3D: betI
COLOMBOS: betI
PortEco: b0313


Product      
Name: DNA-binding transcriptional repressor BetI
Synonym(s): BetI
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 21.815
Isoelectric point: 10.716
Motif(s):
 
Type Positions Sequence
8 -> 68 SIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL
31 -> 50 TIAQIARRAGVSTGIISHYF
85 -> 192 EQRLQAIVGGNFDETQVSSAAMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPREQAQEAGYGLAALIDGLWLRAALSGKPLDKTRANSLTRHFITQHL
14 -> 59 LIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006970 - response to osmotic stress
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0019285 - glycine betaine biosynthetic process from choline
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Lamark T., et al., 1991
[2] Rkenes TP., et al., 1996
External database links:  
ECOCYC:
PD00251
ECOLIWIKI:
b0313
INTERPRO:
IPR017757
INTERPRO:
IPR039538
INTERPRO:
IPR039419
INTERPRO:
IPR036271
INTERPRO:
IPR001647
INTERPRO:
IPR009057
INTERPRO:
IPR023772
MODBASE:
P17446
PANTHER:
PTHR30328
PFAM:
PF00440
PFAM:
PF13977
PRIDE:
P17446
PRINTS:
PR00455
PRODB:
PRO_000022209
PROSITE:
PS01081
PROSITE:
PS50977
PROTEINMODELPORTAL:
P17446
REFSEQ:
NP_414847
SMR:
P17446
UNIPROT:
P17446


Operon      
Name: betIBA         
Operon arrangement:
Transcription unit        Promoter
betIBA


Transcriptional Regulation      
Display Regulation             
Activated by: Cra
Repressed by: BetI, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter betAp5 327261 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lamark T., Kaasen I., Eshoo MW., Falkenberg P., McDougall J., Strom AR., 1991, DNA sequence and analysis of the bet genes encoding the osmoregulatory choline-glycine betaine pathway of Escherichia coli., Mol Microbiol 5(5):1049-64

 [2] Rkenes TP., Lamark T., Strom AR., 1996, DNA-binding properties of the BetI repressor protein of Escherichia coli: the inducer choline stimulates BetI-DNA complex formation., J Bacteriol 178(6):1663-70

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB