RegulonDB RegulonDB 10.7: Gene Form
   

bglF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bglF bglB bglG H-NS anti-anti-terminator anti-terminator terminator

Gene      
Name: bglF    Texpresso search in the literature
Synonym(s): ECK3715, EG10115, b3722, bglS
Genome position(nucleotides): 3903720 <-- 3905597 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.17
External database links:  
ASAP:
ABE-0012171
CGSC:
18502
ECHOBASE:
EB0113
OU-MICROARRAY:
b3722
PORTECO:
bglF
REGULONDB:
b3722
STRING:
511145.b3722
M3D: bglF
COLOMBOS: bglF
PortEco: b3722


Product      
Name: β-glucoside specific PTS enzyme II / BglG kinase / BglG phosphatase
Synonym(s): BglF, BglS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 66.483
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
354 -> 374 VVAGSAALTSLFGITEPAVYG
404 -> 424 VYSFGLPSIFTFMQTIPSTGI
141 -> 161 YLILFSASDALFWFFPIILGY
325 -> 345 MIPLLMPAIMAQVGAALGVFL
479 -> 602 ICSPMTGEIVPLIHVADTTFASGLLGKGIAILPSVGEVRSPVAGRIASLFATLHAIGIESDDGVEILIHVGIDTVKLDGKFFSAHVNVGDKVNTGDRLISFDIPAIREAGFDLTTPVLISNSDD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
External database links:  
DIP:
DIP-9215N
ECOCYC:
BGLF-MONOMER
ECOLIWIKI:
b3722
INTERPRO:
IPR003352
INTERPRO:
IPR004719
INTERPRO:
IPR011055
INTERPRO:
IPR011297
INTERPRO:
IPR013013
INTERPRO:
IPR018113
INTERPRO:
IPR001127
INTERPRO:
IPR036878
INTERPRO:
IPR001996
MODBASE:
P08722
PFAM:
PF02378
PFAM:
PF00358
PFAM:
PF00367
PRIDE:
P08722
PRODB:
PRO_000022215
PROSITE:
PS00371
PROSITE:
PS51103
PROSITE:
PS51098
PROSITE:
PS51093
PROSITE:
PS01035
PROTEINMODELPORTAL:
P08722
REFSEQ:
NP_418178
SMR:
P08722
SWISSMODEL:
P08722
UNIPROT:
P08722


Operon      
Name: bglGFB         
Operon arrangement:
Transcription unit        Promoter
bglG
bglGFB
bglG


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO, CRP, RcsB-BglJ
Repressed by: H-NS, Fis, StpA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB