RegulonDB RegulonDB 10.8: Gene Form
   

bglG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bglF bglG phoU LeuO LeuO RcsB-BglJ CRP Fis Fis H-NS anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator bglGp2 bglGp2 bglGp bglGp

Gene      
Name: bglG    Texpresso search in the literature
Synonym(s): ECK3716, EG10116, b3723, bglC
Genome position(nucleotides): 3905731 <-- 3906567 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.89
External database links:  
ASAP:
ABE-0012174
CGSC:
963
ECHOBASE:
EB0114
OU-MICROARRAY:
b3723
PortEco:
bglG
STRING:
511145.b3723
COLOMBOS: bglG


Product      
Name: transcriptional antiterminator BglG
Synonym(s): BglC, BglG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.097
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
67 -> 171 HIPLEVMATCDRIISLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMHLVSAQMSGNME
172 -> 278 DVAGVTQLMREMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQAWQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH
78 -> 164 RIISLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLLWDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMHLVSA
3 -> 56 MQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRAGERINSSGIEKEYALSSHE
182 -> 273 EMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQAWQCAERIAIFIGLQYQRKISPAEIMFLAINIER

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0003723 - RNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-9216N
ECOCYC:
EG10116-MONOMER
ECOLIWIKI:
b3723
INTERPRO:
IPR036650
INTERPRO:
IPR036634
INTERPRO:
IPR011608
INTERPRO:
IPR004341
INTERPRO:
IPR001550
MINT:
P11989
MODBASE:
P11989
PFAM:
PF00874
PFAM:
PF03123
PRIDE:
P11989
PRODB:
PRO_000022216
PROSITE:
PS51372
PROSITE:
PS00654
REFSEQ:
NP_418179
SMART:
SM01061
SMR:
P11989
SWISSMODEL:
P11989
UNIPROT:
P11989


Operon      
Name: bglGFB         
Operon arrangement:
Transcription unit        Promoter
bglG
bglGFB
bglG


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO, CRP, RcsB-BglJ
Repressed by: H-NS, Fis, StpA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB