RegulonDB RegulonDB 10.10: Gene Form
   

bisC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bisC yiaD tag yiaC terminator terminator ghrBp2 ghrBp2 bisCp7 bisCp7 bisCp3 bisCp3 bisCp6 bisCp6 yiaDp3 yiaDp3 bisCp4 bisCp4 yiaDp4 yiaDp4

Gene      
Name: bisC    Texpresso search in the literature
Synonym(s): ECK3538, EG10124, b3551
Genome position(nucleotides): 3714061 <-- 3716394 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.41
External database links:  
ASAP:
ABE-0011597
CGSC:
951
ECHOBASE:
EB0122
ECOLIHUB:
bisC
OU-MICROARRAY:
b3551
STRING:
511145.b3551
COLOMBOS: bisC


Product      
Name: biotin sulfoxide reductase
Synonym(s): BisC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 85.851
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
12 -> 52 TAAHWGPMLVETDGETVFSSRGALATGMENSLQSAVRDQVH
596 -> 598 ASG
637 -> 739 QVLSAHPAHRLHSQLNYSSLRELYAVANREPVTIHPDDAQERGIQDGDTVRLWNARGQILAGAVISEGIKPGVICIHEGAWPDLDLTADGICKNGAVNVLTKD
747 -> 777 NGCAGNTALAWLEKYNGPELTLTAFEPPASS
583 -> 591 DFCRDPLAH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.9 - methionine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.1 - biotin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0030151 - molybdenum ion binding
GO:0033744 - L-methionine:thioredoxin-disulfide S-oxidoreductase activity
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10124-MONOMER
ECOLIWIKI:
b3551
INTERPRO:
IPR006658
INTERPRO:
IPR006655
INTERPRO:
IPR006656
INTERPRO:
IPR006657
INTERPRO:
IPR041460
INTERPRO:
IPR041954
INTERPRO:
IPR009010
MODBASE:
P20099
PFAM:
PF01568
PFAM:
PF18364
PFAM:
PF00384
PRIDE:
P20099
PROSITE:
PS00932
PROSITE:
PS00490
REFSEQ:
NP_418007
SMR:
P20099
SWISSMODEL:
P20099
UNIPROT:
P20099


Operon      
Name: bisC         
Operon arrangement:
Transcription unit        Promoter
bisC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yiaDp4 3716356 forward nd [ICWHO] [1]
  promoter bisCp4 3716415 reverse nd [ICWHO] [1]
  promoter yiaDp3 3716479 forward nd [ICWHO] [1]
  promoter bisCp6 3716484 reverse nd [ICWHO] [1]
  promoter bisCp3 3716486 reverse nd [ICWHO] [1]
  promoter bisCp7 3716513 reverse nd [ICWHO] [1]
  promoter ghrBp2 3717189 forward nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB