RegulonDB RegulonDB 10.8: Gene Form
   

bolA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tig yajG bolA OmpR ppGpp anti-terminator anti-terminator terminator TSS_568 TSS_568 TSS_567 TSS_567 TSS_566 TSS_566 tigp3 tigp3 TSS_565 (cluster) TSS_565 (cluster) TSS_564 TSS_564 TSS_563 TSS_563 tigp tigp tigp1 tigp1 TSS_561 TSS_561 bolAp1 bolAp1 TSS_559 TSS_559 TSS_558 TSS_558 TSS_557 (cluster) TSS_557 (cluster) bolAp2 bolAp2 yajGp yajGp TSS_555 TSS_555 ampGp4 ampGp4 ampGp6 ampGp6 ampGp5 ampGp5

Gene      
Name: bolA    Texpresso search in the literature
Synonym(s): ECK0429, EG10125, b0435
Genome position(nucleotides): 454472 --> 454789 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.43
External database links:  
ASAP:
ABE-0001508
CGSC:
31032
ECHOBASE:
EB0123
OU-MICROARRAY:
b0435
PortEco:
bolA
STRING:
511145.b0435
COLOMBOS: bolA


Product      
Name: DNA-binding transcriptional dual regulator BolA
Synonym(s): BolA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: BolA
Cellular location: cytosol
Molecular weight: 11.994
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
11 -> 84 LRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0006351 - transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
Reference(s): [1] Aldea M., et al., 1989
[2] Aldea M., et al., 1988
[3] Santos JM., et al., 2002
External database links:  
DIP:
DIP-47926N
ECOCYC:
EG10125-MONOMER
ECOLIWIKI:
b0435
INTERPRO:
IPR002634
INTERPRO:
IPR036065
MINT:
MINT-1238063
MODBASE:
P0ABE2
PANTHER:
PTHR12735
PDB:
2DHM
PFAM:
PF01722
PRIDE:
P0ABE2
PRODB:
PRO_000022230
REFSEQ:
NP_414969
SMR:
P0ABE2
SWISSMODEL:
P0ABE2
UNIPROT:
P0ABE2


Operon      
Name: bolA         
Operon arrangement:
Transcription unit        Promoter
bolA
bolA


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS, OmpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ampGp5 453627 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ampGp6 453684 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ampGp4 453686 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_555 454207 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_557 (cluster) 454351 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_558 454423 forward nd [RS-EPT-CBR] [5]
  promoter TSS_559 454425 forward nd [RS-EPT-CBR] [5]
  promoter TSS_561 454664 forward nd [RS-EPT-CBR] [5]
  promoter tigp 454994 forward nd [AIPP], [RS-EPT-CBR] [1], [5]
  promoter TSS_563 454999 forward nd [RS-EPT-CBR] [5]
  promoter TSS_564 455004 forward nd [RS-EPT-CBR] [5]
  promoter TSS_565 (cluster) 455007 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_566 455378 forward nd [RS-EPT-CBR] [5]
  promoter TSS_567 455382 forward nd [RS-EPT-CBR] [5]
  promoter TSS_568 455792 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Aldea M., Garrido T., Hernandez-Chico C., Vicente M., Kushner SR., 1989, Induction of a growth-phase-dependent promoter triggers transcription of bolA, an Escherichia coli morphogene., EMBO J 8(12):3923-31

 [2] Aldea M., Hernandez-Chico C., de la Campa AG., Kushner SR., Vicente M., 1988, Identification, cloning, and expression of bolA, an ftsZ-dependent morphogene of Escherichia coli., J Bacteriol 170(11):5169-76

 [3] Santos JM., Lobo M., Matos AP., De Pedro MA., Arraiano CM., 2002, The gene bolA regulates dacA (PBP5), dacC (PBP6) and ampC (AmpC), promoting normal morphology in Escherichia coli., Mol Microbiol 45(6):1729-40

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB