RegulonDB RegulonDB 10.8: Gene Form
   

btuD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btuC btuD btuE nlpC TSS_2002 TSS_2002 TSS_2001 TSS_2001 btuEp2 btuEp2 btuEp btuEp btuDp btuDp nlpCp3 nlpCp3 nlpCp5 nlpCp5 TSS_1999 TSS_1999

Gene      
Name: btuD    Texpresso search in the literature
Synonym(s): ECK1707, EG10128, b1709
Genome position(nucleotides): 1792809 <-- 1793558 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.2
External database links:  
ASAP:
ABE-0005707
CGSC:
18499
ECHOBASE:
EB0126
OU-MICROARRAY:
b1709
PortEco:
btuD
STRING:
511145.b1709
COLOMBOS: btuD


Product      
Name: vitamin B12 ABC transporter ATP binding subunit
Synonym(s): BtuD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.081
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
1 -> 233 MSIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQAYGMN
154 -> 160 LLLLDEP
127 -> 130 LSGG
18 -> 162 PLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMN
33 -> 40 GPNGAGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.13 - cobalamin
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0019898 - extrinsic component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015420 - ATPase-coupled vitamin B12 transmembrane transporter activity
biological_process GO:0015889 - cobalamin transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9234N
ECOCYC:
BTUD-MONOMER
ECOLIWIKI:
b1709
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR023693
MINT:
P06611
MODBASE:
P06611
PDB:
4FI3
PDB:
4DBL
PDB:
2QI9
PDB:
1L7V
PDB:
4R9U
PFAM:
PF00005
PRIDE:
P06611
PRODB:
PRO_000022236
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_416224
SMART:
SM00382
SMR:
P06611
UNIPROT:
P06611


Operon      
Name: btuCED         
Operon arrangement:
Transcription unit        Promoter
btuD
btuE
btuE
btuCED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1999 1792637 reverse nd [RS-EPT-CBR] [1]
  promoter nlpCp5 1792760 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter nlpCp3 1792827 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2001 1794137 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2002 1794143 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB