RegulonDB RegulonDB 10.8: Gene Form
   

btuR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sohB rluB yciK btuR CRP CRP sohBp2 sohBp2 sohBp1 sohBp1 TSS_1708 TSS_1708 TSS_1707 TSS_1707 TSS_1706 TSS_1706 TSS_1705 TSS_1705 TSS_1704 (cluster) TSS_1704 (cluster)

Gene      
Name: btuR    Texpresso search in the literature
Synonym(s): ECK1264, EG10130, b1270, cobA
Genome position(nucleotides): 1327767 <-- 1328357 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.25
External database links:  
ASAP:
ABE-0004261
CGSC:
18493
ECHOBASE:
EB0128
OU-MICROARRAY:
b1270
PortEco:
btuR
STRING:
511145.b1270
COLOMBOS: btuR


Product      
Name: cobinamide/cobalamin adenosyltransferase
Synonym(s): BtuR, CobA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.999
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
36 -> 42 GNGKGKT
28 -> 196 RGIIIVFTGNGKGKTTAAFGTATRAVGHGKKVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWDTQNRESDTAACREVWQHAKRMLADSSLDMVLLDELTYMVAYDYLPLEEVVQALNERPHQQTVIITGRGCHRDILELADTVSELRPVKHAFDAGVKAQIGIDY
3 -> 21 DERYQQRQQRVKEKVDARV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.13 - cobalamin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008817 - cob(I)yrinic acid a,c-diamide adenosyltransferase activity
biological_process GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0009236 - cobalamin biosynthetic process
GO:0019250 - aerobic cobalamin biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Lawrence JG., et al., 1995
[2] Lundrigan MD., et al., 1989
External database links:  
ECOCYC:
COBALADENOSYLTRANS-MONOMER
ECOLIWIKI:
b1270
INTERPRO:
IPR003724
INTERPRO:
IPR027417
INTERPRO:
IPR025826
MODBASE:
P0A9H5
PANTHER:
PTHR30069:SF15
PFAM:
PF02572
PFAM:
PF12557
PRIDE:
P0A9H5
PRODB:
PRO_000022239
REFSEQ:
NP_415786
SMR:
P0A9H5
SWISSMODEL:
P0A9H5
UNIPROT:
P0A9H5


Operon      
Name: yciK-btuR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1704 (cluster) 1326918 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1705 1326921 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1706 1326973 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1707 1326992 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1708 1327047 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lawrence JG., Roth JR., 1995, The cobalamin (coenzyme B12) biosynthetic genes of Escherichia coli., J Bacteriol 177(22):6371-80

 [2] Lundrigan MD., Kadner RJ., 1989, Altered cobalamin metabolism in Escherichia coli btuR mutants affects btuB gene regulation., J Bacteriol 171(1):154-61

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB