RegulonDB RegulonDB 10.6.3: Gene Form
   

cadA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cadA dtpC cadB terminator yjdLp3 yjdLp3 yjdLp4 yjdLp4 yjdLp1 yjdLp1 yjdLp2 yjdLp2

Gene      
Name: cadA    Texpresso search in the literature
Synonym(s): ECK4125, EG10131, b4131, ldcI
Genome position(nucleotides): 4356470 <-- 4358617 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.58
External database links:  
ASAP:
ABE-0013526
CGSC:
943
ECHOBASE:
EB0129
ECOCYC:
EG10131
ECOLIHUB:
cadA
OU-MICROARRAY:
b4131
REGULONDB:
b4131
STRING:
511145.b4131
M3D: cadA
COLOMBOS: cadA
PortEco: b4131


Product      
Name: lysine decarboxylase 1
Synonym(s): CadA, LdcI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 81.26
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
130 -> 545 PPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPVGSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTILIDRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEFQHATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKKTLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIYETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRLRTESDGWFFDVWQPDHIDTTECWPLRSDSTWHGFKNIDNEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKYLDEHGIVVEKTGPYNLLFLFSIGIDKTK
570 -> 700 LPSLYREDPEFYENMRIQELAQNIHKLIVHHNLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEVYLDEMVGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIHGAYRQA
14 -> 124 FKEEPIRELHRALERLNFQIVYPNDRDDLLKLIENNARLCGVIFDWDKYNLELCEEISKMNENLPLYAFANTYSTLDVSLNDLRLQISFFEYALGAAEDIANKIKQTTDEY

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0008923 - lysine decarboxylase activity
GO:0042802 - identical protein binding
GO:0097216 - guanosine tetraphosphate binding
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0006554 - lysine catabolic process
External database links:  
DIP:
DIP-35646N
ECOCYC:
LYSDECARBOX-MONOMER
ECOLIWIKI:
b4131
INTERPRO:
IPR036633
INTERPRO:
IPR015424
INTERPRO:
IPR015422
INTERPRO:
IPR015421
INTERPRO:
IPR011193
INTERPRO:
IPR008286
INTERPRO:
IPR005308
INTERPRO:
IPR000310
MINT:
P0A9H3
MODBASE:
P0A9H3
PDB:
4UPB
PDB:
3Q16
PDB:
3N75
PDB:
4UPF
PDB:
5FKX
PDB:
5FL2
PFAM:
PF03711
PFAM:
PF03709
PFAM:
PF01276
PRIDE:
P0A9H3
PRODB:
PRO_000022240
PROSITE:
PS00703
PROTEINMODELPORTAL:
P0A9H3
REFSEQ:
NP_418555
SMR:
P0A9H3
UNIPROT:
P0A9H3


Operon      
Name: cadBA         
Operon arrangement:
Transcription unit        Promoter
cadBA
cadA


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, Lrp, CadC, GadE
Repressed by: H-NS, OmpR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjdLp2 4356413 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjdLp1 4356462 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjdLp4 4356507 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjdLp3 4356517 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB