RegulonDB RegulonDB 10.6.3: Gene Form
   

cadC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cadC cadB yjdQ pheU MlrA FNR H-NS H-NS ArcA H-NS H-NS H-NS cadCp cadCp cadBp cadBp

Gene      
Name: cadC    Texpresso search in the literature
Synonym(s): ECK4127, EG10133, b4133
Genome position(nucleotides): 4360396 <-- 4361934 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.98
External database links:  
ASAP:
ABE-0013532
CGSC:
34231
ECHOBASE:
EB0131
ECOCYC:
EG10133
ECOLIHUB:
cadC
OU-MICROARRAY:
b4133
REGULONDB:
b4133
STRING:
511145.b4133
M3D: cadC
COLOMBOS: cadC
PortEco: b4133


Product      
Name: DNA-binding transcriptional activator CadC
Synonym(s): CadC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: inner membrane
Molecular weight: 57.813
Isoelectric point: 5.499
Motif(s):
 
Type Positions Sequence
24 -> 100 GRQLTLEPRLIDLLVFFAQHSGEVLSRDELIDNVWKRSIVTNHVVTQSISELRKSLKDNDEDSPVYIATVPKRGYKL
121 -> 121 P
191 -> 324 RILLNPRDIDINMVNKSCNSWSSPYQLSYAIGVGDLVATSLNTFSTFMVHDKINYNIDEPSSSGKTLSIAFVNQRQYRAQQCFMSIKLVDNADGSTMLDKRYVITNGNQLAIQNDLLESLSKALNQPWPQRMQE
3 -> 102 QPVVRVGEWLVTPSINQISRNGRQLTLEPRLIDLLVFFAQHSGEVLSRDELIDNVWKRSIVTNHVVTQSISELRKSLKDNDEDSPVYIATVPKRGYKLMV
120 -> 124 PPPIP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Dell CL., et al., 1994
[2] Tetsch L., et al., 2008
[3] Watson N., et al., 1992
External database links:  
DIP:
DIP-9239N
ECOCYC:
PD00436
ECOLIWIKI:
b4133
INTERPRO:
IPR039420
INTERPRO:
IPR036388
INTERPRO:
IPR016032
INTERPRO:
IPR011990
INTERPRO:
IPR001867
MODBASE:
P23890
PANTHER:
PTHR26402
PDB:
3LYA
PDB:
5JU7
PDB:
3LY9
PDB:
3LY8
PDB:
3LY7
PFAM:
PF00486
PRIDE:
P23890
PROSITE:
PS51755
PROTEINMODELPORTAL:
P23890
REFSEQ:
NP_418557
SMART:
SM00862
SMR:
P23890
UNIPROT:
P23890


Operon      
Name: cadC         
Operon arrangement:
Transcription unit        Promoter
cadC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, MlrA, CadC
Repressed by: LeuO, H-NS, OmpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Dell CL., Neely MN., Olson ER., 1994, Altered pH and lysine signalling mutants of cadC, a gene encoding a membrane-bound transcriptional activator of the Escherichia coli cadBA operon., Mol Microbiol 14(1):7-16

 [2] Tetsch L., Koller C., Haneburger I., Jung K., 2008, The membrane-integrated transcriptional activator CadC of Escherichia coli senses lysine indirectly via the interaction with the lysine permease LysP., Mol Microbiol 67(3):570-83

 [3] Watson N., Dunyak DS., Rosey EL., Slonczewski JL., Olson ER., 1992, Identification of elements involved in transcriptional regulation of the Escherichia coli cad operon by external pH., J Bacteriol 174(2):530-40


RegulonDB